KEGG   Camelina sativa (false flax): 109125927Help
Entry
109125927         CDS       T05044                                 

Definition
(RefSeq) probable nucleolar protein 5-1
  KO
K14565  nucleolar protein 58
Organism
csat  Camelina sativa (false flax)
Pathway
csat03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    109125927
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:csat03009]
    109125927
Ribosome biogenesis [BR:csat03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    109125927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop
Motif
Other DBs
NCBI-GeneID: 109125927
NCBI-ProteinID: XP_019084278
Position
8
AA seq 94 aa AA seqDB search
MSLGLSHGLAGYKLKFSSDEKVETIVIKAIGKLDDLDEELNTYSTGLPELYNLHFPELAK
IVHDKIQYVKAVKLMGNRINAPKLDFSEIFYVSN
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgggattgtctcatggccttgccggatacaaactaaagttcagctctgatgaa
aaggtggagaccattgtaatcaaagctataggaaagcttgatgatcttgacgaagagctt
aacacttactcaacggggcttcctgaattgtacaatttgcattttcctgagctcgctaag
atcgtacatgacaaaatccaatatgtcaaggctgtaaagctaatggggaatcggattaat
gcaccaaagctagacttctctgagatattttatgtgtccaattaa

DBGET integrated database retrieval system