KEGG   Camelina sativa (false flax): 109131053Help
Entry
109131053         CDS       T05044                                 

Definition
(RefSeq) phosphopantothenoylcysteine decarboxylase-like
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00770  Pantothenate and CoA biosynthesis
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    109131053
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     109131053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 109131053
NCBI-ProteinID: XP_019097104
Position
19
AA seq 211 aa AA seqDB search
MENAKIDRQDMEVNNTIPPRKPRVLLAASGSVAAIKFGNLCHCFTEWAEVRAVVSKSSLH
FLDKLSLPEEVTLYTDEDEWSSWNKIGDPVLHIELRRWADVLVIAPLSANTLGKIAGGLC
DNLLTCIIRAWDYSKPLFVAPAMNTLMWNNPFTERHLLSLDDLGITLIPPIKKRLACGDY
GNGAMAEPSLIYSTVRLFWESQAHQQSGGTS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgcgaaaatagacaggcaagatatggaagtgaacaacaccataccgccgagg
aagcctcgtgtactacttgctgctagtggaagtgtcgctgctatcaaattcggcaatctc
tgtcattgtttcaccgaatgggcagaagtgagagccgtcgtttccaaatcatctcttcat
ttcctcgataaactgtccctcccagaagaagtgactctgtacactgacgaagatgaatgg
tcaagctggaacaagatcggtgatcccgtccttcacatcgagcttagacgttgggctgat
gttttggtcattgctcctttgtctgctaacaccttaggcaagattgctggtgggctctgt
gataatcttttgacttgcattatacgagcttgggactacagcaaaccactttttgttgca
ccagcgatgaacacattgatgtggaacaaccctttcactgaaaggcatcttttgtcgctt
gatgatctgggaatcacactcattcctcctatcaagaagagactggcctgtggagactac
ggtaatggcgctatggctgagccctctcttatctattccactgtcagactcttctgggaa
tcgcaggctcatcagcaaagtggtggaactagttaa

DBGET integrated database retrieval system