KEGG   Clostridium saccharobutylicum: CLSA_c02060Help
Entry
CLSA_c02060       CDS       T02876                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
csb  Clostridium saccharobutylicum
Pathway
csb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:csb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLSA_c02060 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:csb03011]
    CLSA_c02060 (rplV)
Ribosome [BR:csb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CLSA_c02060 (rplV)
  Bacteria
    CLSA_c02060 (rplV)
  Archaea
    CLSA_c02060 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 SpoIISB_antitox
Motif
Other DBs
NCBI-ProteinID: AGX41258
UniProt: U5ML48
Position
221920..222255
Genome map
AA seq 111 aa AA seqDB search
MEARAIAKYVRMSPTKVGVILDLIRGKQVNEAFAILQYTPREAAVVINKVLKSAVANAEN
NLELNADNLYVSECFVGQGSTLKRFQPHAQGRAFKILKKTSNITVIVKERA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctagagctatagcaaaatatgtcagaatgtctccaacaaaagtaggagtaatt
cttgatttaataagaggaaagcaagttaatgaagcttttgctattttacaatatactcca
agagaagcagcagtagtaattaacaaagttttaaagtcagctgttgcaaatgcagaaaat
aatttagagttaaatgctgacaacttatatgtttcagaatgttttgttggtcaaggatca
acattaaagagatttcaacctcatgctcaaggtagagcattcaaaatcttaaagaaaaca
agcaatataacagtaattgttaaagaaagagcttag

DBGET integrated database retrieval system