KEGG   Clostridium saccharobutylicum: CLSA_c08730Help
Entry
CLSA_c08730       CDS       T02876                                 

Gene name
ppm
Definition
(GenBank) phosphoenolpyruvate phosphomutase Ppm
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb00440  Phosphonate and phosphinate metabolism
csb01100  Metabolic pathways
csb01120  Microbial metabolism in diverse environments
csb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CLSA_c08730 (ppm)
Enzymes [BR:csb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CLSA_c08730 (ppm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like 4HFCP_synth DUF3173
Motif
Other DBs
NCBI-ProteinID: AGX41886
UniProt: U5MQG2
Position
957552..958850
Genome map
AA seq 432 aa AA seqDB search
MKKVYVAMSADIIHQGHLNVLNEAKKLGDVIVGLHTDDVIRGYWRNPIMKYDERKEVIEN
IKGVVQVVLQDTLDQVPNLLDIKPDYVVHGDDWIEGSQKVFRDKVINAIKEWGGKLVEVT
YTQGVSISKLDEQLAEIGITPQKRMKSLKELIYSKKPVRILEAHNGLTGLIVEKTKVEKN
GKIKEFDGMWISSLCDSTAKGKPDIELVDLTSRLNTINDILEVTTKPIIVDGDTGGQIEH
FVYTVKTLERLGVSAIIIEDKTGLKKNSLFGTEVKQTQDSMEHFSEKIKAGREARVTSDF
MIISRIESLILKAGMDDAINRAKAYIEAGTDGIMIHSKEKDGKEIVEFCKRYNEIENKVP
LVVVPTSYNFMKEDELVELGINVIIYANHLIRSAYPAMVNTAKSILENERSKEASSNCMP
IKEILTLIPGGM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtttatgtagctatgagcgcagatataattcatcaaggacatttaaatgta
ttaaatgaagctaaaaaattaggagatgtaatagtagggttacatacagatgatgtaatt
agaggctattggagaaatccaataatgaagtatgacgaaagaaaagaagtgattgaaaat
attaagggagttgtacaagtagtacttcaagatactttagaccaagttccaaatttgtta
gatataaaacctgattatgttgttcacggtgatgattggatagaaggatctcaaaaggtg
tttagagataaagttataaatgcaataaaagaatggggaggaaaacttgttgaagttact
tatactcaaggtgtatctatttcaaaattagatgaacaattagcggaaatcggaataact
cctcaaaagagaatgaaaagtttaaaggaattaatttattctaaaaagccagtaaggata
cttgaagctcataatggtttaacaggattgattgttgaaaaaactaaagttgaaaagaat
ggtaagattaaagaatttgatggaatgtggataagttccttatgtgattcaacggctaaa
ggtaagccagatatagaattggtagatttaacatcaaggttaaacacaattaatgatatt
ttagaagttacaacaaagccaataattgttgatggtgatacaggtggacaaattgagcat
tttgtttatacagttaaaactctagaaagattaggtgtatcagcaataattattgaagat
aagacaggccttaagaaaaattctttatttggaactgaagttaaacaaacacaagatagt
atggaacatttctcggaaaaaataaaagcaggaagagaagctagagtaactagcgatttt
atgataatttcaagaattgaaagtttaatattaaaagcgggaatggatgatgcaataaat
agggcaaaagcttatattgaagctggtactgatggaattatgattcatagtaaagagaaa
gacggaaaagagatagttgaattttgtaaaagatataatgaaattgaaaataaggtgcca
ttagtggtagttccaacttcttataattttatgaaggaagatgaattagttgaattgggc
ataaatgtgattatttacgcaaatcatctcattagaagtgcatacccagcaatggtgaat
actgcaaagagtatattagaaaatgaaagatctaaggaagcctcatctaactgtatgcca
ataaaggaaatacttacattgattcctggtggaatgtaa

DBGET integrated database retrieval system