KEGG   Clostridium saccharobutylicum: CLSA_c23770Help
Entry
CLSA_c23770       CDS       T02876                                 

Gene name
pit
Definition
(GenBank) low-affinity inorganic phosphate transporter Pit
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
csb  Clostridium saccharobutylicum
Brite
KEGG Orthology (KO) [BR:csb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CLSA_c23770 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGX43351
UniProt: U5MUL9
Position
complement(2687774..2688778)
Genome map
AA seq 334 aa AA seqDB search
MLSTMTITVLIVVFVLIFDFINGFHDTATAVATSITTRALRPMPAIILCSIFNFIGAFSG
TAVAKTVGENIVSHSSIPEWVILGILISSIIWNLITWYFGIPSSSSHALIGALVGGGIAY
NHTFNVVNWYNLFHSVVVWLFISPIIGFTVGYILMKILNYVLRPFNYHFVNKLFLKLQVA
AGAFMALNHGGNDAQKSMGMITMALLSGGFISANEFKVPTWVIICCASAMALGTSLGGKK
IIKTMGSGMAKLTPVNGFAAQTGAASVILMATLFHAPVSTTHIISTTVMGVGASKRLKSV
KWGVAKNIVWAWVLTIPVTAVLSALIIDIMKLFM
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtactatgaccataacagtattaatagtagtatttgtattaatatttgatttt
ataaatggatttcatgatacagctacagcagttgccacttctattacaacaagagcactt
agaccaatgcctgctataatattatgttctatatttaattttataggtgcattttctgga
acagcagttgctaaaactgttggtgaaaatattgtgagtcattcatcaatacctgaatgg
gttatattaggtattttaatttcttctataatttggaatttgattacatggtattttgga
attccaagcagttcttctcatgctttaataggagcattagtaggtggtggaattgcatat
aatcatacatttaatgtagttaattggtataatcttttccacagtgtagtggtgtggtta
tttatatctccaattataggtttcacagtaggatacatattaatgaaaatattaaattat
gttctaagaccttttaactatcactttgtaaataagttatttttaaaacttcaagttgca
gcaggagcatttatggcgttaaatcatggtggaaatgatgctcaaaagtctatgggaatg
ataactatggctttactaagtggcggatttataagtgcaaatgaatttaaagtacctact
tgggttataatatgttgcgcttcagctatggcacttggaacatctttaggtggtaaaaaa
attatcaaaactatgggaagtggaatggcaaaattaacaccagtaaatggttttgcagct
caaacgggagcagcatcagtaattttgatggcaacactattccatgcgccagttagcaca
actcatataatttcaacaactgtaatgggtgttggagcatctaaaagacttaaatcagta
aaatggggagtagctaaaaacatagtttgggcttgggtattaactataccagtaacagca
gttctttcagcattgataatagatataatgaagttatttatgtaa

DBGET integrated database retrieval system