KEGG   Clostridium saccharobutylicum: CLSA_c28130Help
Entry
CLSA_c28130       CDS       T02876                                 

Gene name
vraB
Definition
(GenBank) putative acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb00071  Fatty acid degradation
csb00072  Synthesis and degradation of ketone bodies
csb00280  Valine, leucine and isoleucine degradation
csb00310  Lysine degradation
csb00362  Benzoate degradation
csb00380  Tryptophan metabolism
csb00620  Pyruvate metabolism
csb00630  Glyoxylate and dicarboxylate metabolism
csb00640  Propanoate metabolism
csb00650  Butanoate metabolism
csb00900  Terpenoid backbone biosynthesis
csb01100  Metabolic pathways
csb01110  Biosynthesis of secondary metabolites
csb01120  Microbial metabolism in diverse environments
csb01130  Biosynthesis of antibiotics
csb01200  Carbon metabolism
csb01212  Fatty acid metabolism
csb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLSA_c28130 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    CLSA_c28130 (vraB)
   00640 Propanoate metabolism
    CLSA_c28130 (vraB)
   00650 Butanoate metabolism
    CLSA_c28130 (vraB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLSA_c28130 (vraB)
   00072 Synthesis and degradation of ketone bodies
    CLSA_c28130 (vraB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLSA_c28130 (vraB)
   00310 Lysine degradation
    CLSA_c28130 (vraB)
   00380 Tryptophan metabolism
    CLSA_c28130 (vraB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLSA_c28130 (vraB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLSA_c28130 (vraB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLSA_c28130 (vraB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csb04147]
    CLSA_c28130 (vraB)
Enzymes [BR:csb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLSA_c28130 (vraB)
Exosome [BR:csb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLSA_c28130 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGX43782
UniProt: U5MWE2
Position
complement(3149021..3150157)
Genome map
AA seq 378 aa AA seqDB search
MEDVYIIGGLRSNIGLKNGIFKNMLPEKLGGEILKCLVGRYDLSEIDEIICGNAVGTGGN
IARLMTLYAGVSENVPAYTVDMQCASGCACIDIAFSKISSGQCDLIIAGGFESTSMQPAR
IYNKNDSRYNEENPIYWTAQFSPNEIGENVMLKAAERVVQKYNITNEELNFWILESHKRA
KLARKKEVLSDIILSLDESNYDEGIRDNMNQRLINRMKPLLFKEGKITATNTCLINDGAA
FIALCSKKFIQENKVKPIAKVVNTSLIGVNPLYSPVSAMKAADKLIKSVRLTYESISAFE
FNEAFAVIDVMFEREHPRLIDRYNKFGGALAYGHPYGASGGIIMLHLIKSLQSVSGKYGV
CAIAAAGGIGSAILIERI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgtttatattataggcggtttaagaagtaacattggactaaaaaatgggata
tttaaaaatatgctgcctgaaaaactgggaggagaaattttaaaatgtttagttggtaga
tatgatttgagtgaaattgatgaaataatatgcggaaatgcggtaggcacaggcggaaat
attgcaagattaatgactttatatgctggagtttcagaaaatgtaccagcatatacagtt
gatatgcaatgtgcatcaggatgtgcttgtatagatattgctttttctaaaataagcagt
ggtcaatgtgatttgattattgctggtggttttgaaagcacatctatgcagccagctaga
atttataataaaaatgatagcagatataacgaagaaaatccaatatattggacagcacaa
ttttcaccaaatgaaattggagaaaatgttatgttaaaagctgcggaaagagttgtacaa
aagtacaatattactaatgaggaattaaatttttggattttagaaagtcataagagagct
aaattagctagaaaaaaagaagttttaagtgatattattttatctttagatgaaagcaat
tatgatgaaggcataagagataatatgaatcaaagattgataaatagaatgaaacctctt
ttatttaaggaaggtaagattacagcaacgaatacttgtcttattaatgatggtgcagca
tttattgcattatgttcaaagaaatttattcaagaaaacaaggtgaaacctatagctaaa
gttgtgaataccagtttgataggagtaaatccattatattctccagtttcagctatgaaa
gcagctgataaactgattaaatcagttaggttaacatatgaatctatctcagcatttgaa
tttaacgaagcatttgctgtaatagatgttatgtttgaacgagagcatcctagattaatt
gatagatataataaatttggaggagcattagcttatggacatccatatggagcttcgggt
gggataataatgttacatttaattaaaagtttacaatcggttagtggaaaatatggagtt
tgtgctattgcagcagcaggaggaattggttcagcaatattaattgaaagaatatag

DBGET integrated database retrieval system