KEGG   Clostridium saccharobutylicum: CLSA_c30630Help
Entry
CLSA_c30630       CDS       T02876                                 

Gene name
trpH
Definition
(GenBank) protein TrpH
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
csb  Clostridium saccharobutylicum
Brite
KEGG Orthology (KO) [BR:csb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLSA_c30630 (trpH)
Enzymes [BR:csb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CLSA_c30630 (trpH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AGX44029
UniProt: U5MTC9
Position
3381010..3381852
Genome map
AA seq 280 aa AA seqDB search
MLKVDFHVHTSCSDGTLSPKEVIQRANKNNVKCLSITDHDTLSGLTDAIDEALNYDITLI
PGIELSTQHNDESIHILGFFKDNSFKNEELIEELNKIKNHRILRAKSIVNKLKEEFNIEI
SFEKILKDSKDTVARPHIARAIINSGYPYTFEEIFDNFIGKGCKAYVPTLKLSTLEGVKL
LKKYNALVFLAHPKLISKSNLTEFLSMSFDGIEGIYCQNTIKETINFLKFADENNLLVSC
GSDFHGNIESDTRHGDIGSMELPSKYFLNLLDALGINSYR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagtggattttcatgttcatacctcttgttctgatggaacattatctcccaag
gaagttattcaacgagctaataaaaataatgtaaaatgcttatcaataactgatcatgat
actttaagtggattaactgatgctatagacgaagccttaaattatgatattacattaatt
cctggaattgaattatcaacacaacataacgatgagagtatacatattttaggtttcttt
aaagacaacagttttaaaaatgaagaacttattgaagaattaaataaaattaaaaaccat
agaattcttagagctaaatctatagttaataaacttaaagaagaatttaacattgaaata
agctttgaaaaaatacttaaagattctaaagataccgtggctaggcctcatatagctaga
gctataattaattctggttatccttatacatttgaagaaatatttgataactttattgga
aaaggctgcaaagcttatgttcctacactaaagttatctacacttgaaggagtaaaactt
ttaaaaaaatataatgctcttgtatttttagctcatccaaaattaatctctaaatcaaac
ctgactgaattcttaagtatgagttttgatgggattgaaggaatctattgtcaaaatact
attaaagaaactatcaactttttgaaatttgctgacgaaaacaatttattggtatcatgt
ggttctgattttcatggaaacattgaatccgatactcgccatggagatataggatccatg
gaacttccatccaaatactttttgaacttactagatgcattaggtataaattcttataga
taa

DBGET integrated database retrieval system