KEGG   Clostridium saccharobutylicum: CLSA_c31960Help
Entry
CLSA_c31960       CDS       T02876                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb00860  Porphyrin and chlorophyll metabolism
csb01100  Metabolic pathways
Module
csb_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:csb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLSA_c31960 (cobQ)
Enzymes [BR:csb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CLSA_c31960 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase DUF1611 SNO DJ-1_PfpI Peptidase_C26 MobB Peptidase_S51 LSDAT_prok
Motif
Other DBs
NCBI-ProteinID: AGX44162
UniProt: U5MXH9
Position
complement(3525944..3527443)
Genome map
AA seq 499 aa AA seqDB search
MNKKSIMFLGTASSVGKSTLATALCRFLRNKGLNVAPFKALNISLNSYVTKEGLEMGRAQ
VVQAEACNLEPNALMNPILLKPSGGHTQVIVNGKVYCNIEPYKYKELNEKLKYYVKESYN
KLSENHDIIVLEGSGSCAEINLRNSDIANMAMAEMADAPVILVSDIDRGGVFASIVGTLQ
LLTEDERARVKGVIINKFRGNKDLFKSGVKQLEEIIKLPVLGVMPYEKFDIEDEDSVTER
IKNEEQEGTLDIVVIRLSHMSNFTDFSMLERISGVTVRYVKDPKELKNPNLIIIPGTKNT
IEDLRVLKENKLFYKIKEAKENGIPIFGICGGYQMLGTFVLDKLGVEGEISQEEGFGFLD
IKTRFNENKITKQTKAEVLCNLTHVNRIEGSILCGYEIHNGISKIGKKAIPFIKDSEGSI
IGVCDSNKIVAGTYLHGIFDSEEFINSFVKSLKEKNNIMVSEEDIIVKVNEYKDNEYDRL
AKVFEENIQIDVLRNMIDI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaaagtatcatgtttttaggtacagcatcttctgttggaaaaagtactttg
gcaacagcgctatgcagattcttaagaaataagggcttaaatgtagctccttttaaagct
ttgaatatttcattaaattcatatgttacaaaagaaggtttggaaatgggaagagcgcag
gtagttcaggcagaagcttgtaatcttgaaccaaatgcacttatgaatcctattttatta
aagccaagtggtggccatacacaagtaattgttaatggaaaggtttattgtaatattgaa
ccttataagtataaagaattaaatgaaaagttaaagtattatgttaaagaatcttataat
aaattaagtgagaatcatgatattattgttctagagggttctggaagttgtgcagaaatc
aatttaaggaatagtgacatagctaatatggctatggctgagatggcagatgctcctgtg
attttagtttcagatattgatagaggaggcgtgttcgcatccattgttggaacactgcaa
ttattaacagaagatgaaagagctagagtaaaaggtgtaataataaataaatttagagga
aataaggatttatttaaatctggagtgaaacaattagaagaaattataaaacttcctgtt
cttggagttatgccatatgaaaaatttgatattgaagatgaggatagtgtaactgagaga
attaaaaatgaagaacaagaaggaactttagatattgtagttatcagactttcacatatg
tcaaattttactgatttttctatgctagaaagaataagtggagttacagttagatatgta
aaagatcctaaagaattaaaaaatcctaatttaataataattcctggtactaaaaataca
atagaggatttaagggttttaaaggagaataaattattttataagataaaagaagcaaaa
gaaaatggaatacctatatttggaatatgtggaggatatcaaatgctcggaacttttgtc
cttgataagttaggggtagaaggggaaatttcacaagaagaaggttttggattcttagat
ataaaaacaagatttaatgaaaataaaattactaagcaaacaaaagcagaagtattatgt
aatttgacgcatgtaaataggatagaaggaagcatactctgcggttatgagattcataat
ggtataagtaaaataggtaaaaaagcaattccttttattaaagattcagaaggctcaatc
ataggtgtatgtgatagcaataaaattgtggcagggacatacttacatggtatctttgat
tcagaagaatttataaattcatttgtaaaatctcttaaggaaaaaaataatattatggtg
tcagaagaagatatcatagtaaaagtaaatgagtataaagataatgagtatgacaggtta
gcaaaagtttttgaagaaaatatacaaattgatgtattaagaaatatgattgatatttaa

DBGET integrated database retrieval system