KEGG   Clostridium saccharobutylicum: CLSA_c40350Help
Entry
CLSA_c40350       CDS       T02876                                 

Gene name
rnr
Definition
(GenBank) ribonuclease R
  KO
K12573  ribonuclease R [EC:3.1.13.1]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:csb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CLSA_c40350 (rnr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csb03019]
    CLSA_c40350 (rnr)
   03016 Transfer RNA biogenesis [BR:csb03016]
    CLSA_c40350 (rnr)
Enzymes [BR:csb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     CLSA_c40350 (rnr)
Messenger RNA biogenesis [BR:csb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     CLSA_c40350 (rnr)
Transfer RNA biogenesis [BR:csb03016]
 Prokaryotic Type
  tRNA degradation factors
   CLSA_c40350 (rnr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB CSD2 OB_RNB S1 OB_Dis3 CSD RNase_II_C_S1
Motif
Other DBs
NCBI-ProteinID: AGX44995
UniProt: U5MWN3
Position
complement(4463417..4465663)
Genome map
AA seq 748 aa AA seqDB search
MVVYRYKGIIYRKLYSGGIVMGIKQTLASFMRETAYTPMDIEELVAIFDIKKNEYNAFKK
TLKMMEHEGIIRRTKTNRYMIAEGEEHQEEGLVIGTLQSHAKGFGFLIPEEEGQKDVFIP
SNCINGAFNGDKISVKVTREDTKTKKREGIVVEILERNTSKIVGVYEDSKNFGFVISEDT
RMTQDIFISKKDRNNAKDGDVVIVKITKWPDGKRKPEGVVTEILGRKGDRGIDILMIIKK
LGLPEEFPTKVLNFAENISEEIDEQEYLSRRDLRDLRMVTIDGEDAKDLDDAVSIEKLPN
GNFRLGVHIADVTNYVRENNPLDREALKRATSVYLIDRVVPMLPRKLSNGICSLNPRVDR
LTLTCFMEINNKGMVVDHEIVESIIKTNERMTYTDVTKILKDHDEELIKKYDYLYDDFKL
MEELCNILREKRTRRGAIDFEIAEAKIILNELGKPIEIKPYEREIANRMIEEFMLAANET
VAEHMFKTKIPFVYRIHESPDEEKLTKFKEFVYNLGYNISWTEEIHPKSFQEILEKVKGQ
NEETVVSTLLLRSMMQAKYAPACIGHFGLAAQYYCHFTSPIRRYPDLQIHRIIKEYLHAQ
IDEKRYNRLKNIVGYAAKQSSEMERKAQDAEREVDDLKKAEYMQDRIGEEFEGIISSVTS
FGIFVELPSTIEGLVHVNDLNDDYYVFNESHLSLTGERTKKVYKLGDKVKVECVDVDIAN
REIFFRITEEPKREDEIADKDDSQIQIK
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggtagtatatagatacaaaggaataatatatagaaaattgtatagtggaggaatagtt
atgggaataaagcaaacattagcaagttttatgagagaaactgcatataccccaatggat
attgaagaattagttgccatatttgatataaagaaaaatgaatataatgcatttaagaaa
actttgaaaatgatggagcatgaaggaataataagaagaacaaaaactaatagatatatg
atagcagaaggtgaagagcatcaggaagaaggattagttattggaactctacaatctcat
gcaaaaggttttggatttttaattcctgaagaagaaggacagaaggatgtctttattcct
agtaattgtataaatggagcttttaatggtgataaaatctcagtaaaagtaacaagggaa
gatacaaagactaagaaaagggaaggtatagtagttgaaatccttgaaagaaatacaagt
aaaattgttggagtatatgaagattcaaaaaactttggctttgtaatttcagaagatact
agaatgacgcaagatatatttatatcaaagaaagacagaaacaatgctaaagatggggac
gtagttatagttaaaataacaaaatggccagatggaaaaagaaaaccagaaggtgttgtt
acagaaattttaggtagaaaaggcgatagaggaatagatattttaatgatcattaaaaag
cttggattgcctgaagaatttcctactaaagtattaaattttgctgaaaatatttccgag
gaaattgatgaacaagagtatctaagcagaagagatttaagagatttaagaatggtaaca
atagatggtgaagatgctaaggatttagatgatgctgtatctattgaaaagttaccaaat
gggaactttagactaggagttcatattgcggatgtaactaattatgttagagagaataat
ccattggatagggaagcattaaaaagagcaacttcggtttatttaattgatagagttgtt
ccaatgctacctagaaaattatcaaatggtatatgttcgttaaatcctagagtagacaga
ctaacattaacttgttttatggaaataaacaataagggaatggttgtagatcatgaaata
gttgaatctattattaaaactaatgaaagaatgacatatacagatgttacaaagatttta
aaagatcatgatgaagagttaataaaaaaatatgattatctttatgatgattttaagtta
atggaagagctttgtaatattttaagagagaagagaactagaagaggagccattgatttt
gaaatcgcagaagctaaaataatattaaatgaattaggtaaaccaattgagattaaacct
tatgaacgtgaaattgctaatagaatgattgaagagtttatgttagcagctaatgaaaca
gtagctgagcatatgtttaaaactaaaataccgtttgtatatagaatccatgaaagccct
gatgaagaaaaactaacaaagtttaaggaatttgtatataatttaggatacaatattagt
tggacagaagaaatacatcctaagagtttccaagaaattttagagaaagttaaaggacaa
aatgaagaaactgttgtaagtaccttattattacgttcaatgatgcaagctaaatatgca
ccagcatgtataggacattttggcttagcagctcaatattattgtcattttacttctcca
ataagaagatatccagatttacaaattcatagaataataaaggaatatttgcatgcacaa
atagatgaaaagagatacaataggttgaaaaatatagttggatatgcagctaagcagtca
tcagaaatggaaagaaaggcacaagatgctgaaagagaagttgatgatttaaagaaagca
gagtatatgcaagatagaattggagaagaatttgaaggaattatatcttcagttacaagc
tttggaatattcgttgaattaccaagtacaattgaagggttagttcatgttaatgattta
aatgatgattattatgtatttaatgaatcacatctttcactaactggagaaagaactaaa
aaggtatataaattaggagataaggttaaagttgaatgtgtggatgtagatatagctaat
agagagattttctttagaattacagaagaacctaagagagaagatgaaatagctgataaa
gatgatagtcaaattcaaattaaatga

DBGET integrated database retrieval system