KEGG   Clostridium saccharobutylicum: CLSA_c40760Help
Entry
CLSA_c40760       CDS       T02876                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:csb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLSA_c40760 (bdhA)
Enzymes [BR:csb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CLSA_c40760 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CLSA_c40760 (bdhA)
    1.1.1.-  
     CLSA_c40760 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C ApbA ADH_zinc_N_2 PALP Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AGX45036
UniProt: U5MZE0
Position
complement(4512052..4513125)
Genome map
AA seq 357 aa AA seqDB search
MKAALWYAKKDVRVEEIEEPKVIDNGVKIKVKWCGICGSDLHEYLGGPIFIPVGEPHPLS
GTTAPVVLGHEFSGDVVEVGKNVTNFKPGDRVIVEPIVACGKCPACLEGKYNLCSSLGFH
GLCGSGGGFAEYTVFPEKFVHKIPDEMSYEQAALVEPMTVALHSIRIGNFRTGDTALVLG
SGPIGLATIECLKAAGAKLIIVLQRKSIRQEYAKRAGADVVLDPNEVDIVEEVKKLTNGV
GVDVAFETTGAQIGFDTGIDSLKFEGTLVVTSIWEDGVKFNPNTLVFTEKKVVGTLAYRH
EFPATIAQMNDGRIKAEGYVTKKIHLDDIVEEGFGALTGPEKKKHVKILVTPDKNLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgcaaagaaagatgttagagtagaggaaatagaagaacca
aaagttatagataacggtgtaaaaattaaagtaaaatggtgtggaatttgtggatcagat
ttacatgagtatctaggaggacctatatttataccagtaggtgagccacatccattaagt
ggtacaacagctcctgtagttttaggtcatgaattttctggagatgttgtagaagtaggt
aagaatgtaactaattttaaaccaggagacagggtaatagttgaacctatagttgcatgt
ggaaaatgtccagcatgtttagaaggaaaatataatttatgttcttctctaggatttcat
ggactttgtggaagtggtggaggatttgctgaatatacagtctttccagaaaaatttgtg
cataaaataccagatgaaatgtcttacgaacaagcagctttagttgagccaatgacagta
gcactacattcaattagaataggaaactttagaactggagatactgcattagttttagga
tcaggtccgataggattagcaacaatagaatgtttaaaagcagctggtgcaaaattaata
atagtattacaaagaaaatcaataagacaagaatatgcaaagagagcaggagctgatgta
gtattagatcctaatgaagtagatatagtagaagaagttaaaaaacttacaaatggggtt
ggagttgatgtagcgttcgaaaccacaggagctcaaataggttttgatacaggtatcgac
agtttaaaatttgaaggaactttagttgtaacaagtatatgggaagatggtgttaaattt
aatcctaatacactagtatttactgaaaagaaagttgtcggaacattagcatatagacat
gaatttccagcaactattgctcaaatgaatgatggcagaataaaagctgaaggatatgta
actaagaaaatacatttagatgatatagtagaagaaggatttggtgcattaacaggtcca
gaaaagaaaaagcatgttaagatattagtaacaccagataaaaatcttttataa

DBGET integrated database retrieval system