KEGG   Caldicellulosiruptor saccharolyticus: Csac_1171
Entry
Csac_1171         CDS       T00506                                 
Name
(GenBank) Alanine racemase
Organism
csc  Caldicellulosiruptor saccharolyticus
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_31 HTH_Tnp_ISL3 HTH_23 Trp_repressor TetR_N HTH_26 HTH_7 MarR_2 HTH_24 HTH_Crp_2 HTH_IclR
Other DBs
NCBI-ProteinID: ABP66776
UniProt: A4XIP1
Position
1329793..1330776
AA seq 327 aa
MPTVKDVAQRAGVSVATVSRVLNNSEKVSEQTRQKVLKAIEELGFKPNLLARNFRKDKSN
LILVILPTIANAYFARVVKGIEDTARKNGYGILLCTTQNSPEIAAEYLKLIEKKQVDGAI
IASAKIEINFCKDLDTRRIVQACEFYPFLDSSCVLIDHRKAFYDVVDYLIKKGKKNILCA
IGNEDIPSEFERKEGYRKALEENGLQFREENVIRCSYGWTELYEKLKNLCCLKKYDAIAC
SSDLMAVGAIKAAKALGLKVPDEFSVTGFDNIMMSRLYEPSITTVAQPMYSIGEKAAQIL
IDTLESPGAFKKQKIILPHELKTRESA
NT seq 984 nt   +upstreamnt  +downstreamnt
atgccaacagtcaaagatgttgcccaaagagctggtgtttctgttgcaacagtttcaagg
gtgctgaataattcagaaaaggtctctgaacaaacacgacagaaggttttaaaggctatt
gaagagctgggttttaaaccaaaccttcttgcaagaaacttcagaaaggacaagtcaaat
ctgatattagttatacttcccacaattgccaatgcatactttgcacgtgttgtcaaagga
attgaggataccgcacgaaagaatggttatggaatacttctttgcacaacacaaaacagt
cctgagattgctgctgagtatttaaagcttatagaaaaaaaacaggttgatggagctata
attgcctctgcaaagattgaaattaatttttgcaaagatcttgatacaagaaggattgtt
caggcatgcgagttttacccctttttggactcatcttgcgtgcttatagatcacagaaaa
gctttttacgatgtcgtagactaccttataaaaaaaggcaagaaaaatattttatgcgca
attggaaacgaggacatcccttctgagtttgaaaggaaagaaggatacagaaaagctctt
gaagaaaatggacttcagtttagagaagagaatgtcataagatgcagctatggctggaca
gagctttatgagaagctcaaaaacctttgctgtcttaaaaaatacgatgcaattgcttgt
tcttcagatttgatggcagttggggcaataaaggctgccaaagctctggggcttaaagtt
cctgatgagttttctgtgacaggttttgacaatatcatgatgtcaagattgtatgagcct
tcaatcacaacagttgcacagcctatgtattcaataggcgagaaggcagcccagattttg
attgatacgcttgaaagtcctggtgcttttaaaaaacaaaaaattatacttcctcatgaa
ctcaagacaagagaatctgcttga

DBGET integrated database retrieval system