KEGG   Caldicellulosiruptor saccharolyticus: Csac_0185Help
Entry
Csac_0185         CDS       T00506                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00450  Selenocompound metabolism
csc00970  Aminoacyl-tRNA biosynthesis
csc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Csac_0185
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Csac_0185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csc01007]
    Csac_0185
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csc03016]
    Csac_0185
Enzymes [BR:csc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Csac_0185
Amino acid related enzymes [BR:csc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Csac_0185
Transfer RNA biogenesis [BR:csc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Csac_0185
 Prokaryotic type
   Other AARSs
    Csac_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_ligase_ZBD tRNA-synt_1c DUF16
Motif
Other DBs
NCBI-ProteinID: ABP65833
UniProt: A4XFZ8
Position
191025..192992
Genome map
AA seq 655 aa AA seqDB search
MEKPKFYITTPIYYPSDKLHIGHTYCTVAADTLARYKRLQGYDVFFLTGTDEHGQKIERK
AQEVGKTPQKYVDEIVASIKDLWKLMNISYDDFIRTTEERHKKVVQKIFTKLYEQGDIYK
SEYEGWYCTPCESFWLDRQLVDGKCPDCGRPVERAREESYFFRLSKYQDALVKYIEEHPD
FIVPQSRANEMINNFIKPGLEDVCVSRTTLKWGIPVPFDPKHVIYVWIDALSNYITALGY
MSEDDSKFKKYWPADVHLVGKEIVRFHTIIWPAMLMALGLPLPKMVFGHGWLLLEGGKMS
KSKGNVVDPVVLAQKYGVDSLRYFLLREIPFGADGYFSEDALKTRHNSDLANDLGNLLSR
TVAMIEKYFDGIIHLPEVKEDLDNELITLAKEVYEKVCKCLDELQFSNALIEIWKLIARA
NKYIDETMPWVLGRDKSKHPRLKTVLYNLAEVLRIVAILIEPFMPQTTPKMLAQLGISKD
ENPDITSWESAATFGLIRDGTKVKRDQPLFPRIVDEKEEQEVQEQNKTDVTKIEGAVPAD
DKKVDEKKEYISIEDFSKIELKVAKILEAEKIEGADKLLKLIVDLGDEKRQIVAGIAKHY
SPDQLIGKKIVVVANLKPAKLRGVESQGMLLAASIDDELCLITPEKDIKEGARVK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccaaaattttatataacaacgcctatatactatccatcggacaaacttcat
attggtcacacatactgcacagttgcagccgacactttagcacgatacaaaaggctgcaa
gggtatgatgtgtttttcttaacaggaacagatgagcatggacaaaagatagaaagaaaa
gctcaggaggttggcaagacacctcaaaaatatgttgatgaaatagttgcgtcaataaaa
gacctttggaagcttatgaacatctcatacgatgactttataagaacaacagaagagcgc
cacaagaaggttgtccagaaaatatttaccaagctttatgagcagggcgatatctacaag
agcgaatatgagggttggtactgtacaccgtgcgagtcgttctggcttgacaggcaactt
gttgatggcaagtgccctgactgtggcagacctgttgaaagggcaagagaagagagctac
ttttttagactctcaaaataccaagatgcacttgtaaagtatattgaagagcatccggat
tttattgttccacagtcgcgcgcaaatgagatgataaacaactttataaaaccaggactt
gaagatgtatgcgtttcaagaacaactttaaaatggggaatccctgtgccatttgaccca
aaacatgtaatctatgtttggatagacgcactttcaaactatataacagcactggggtat
atgagcgaggatgacagcaagttcaaaaaatactggccggcagatgttcaccttgttgga
aaagaaattgtgagattccacacaataatttggccagcaatgctgatggcactgggtctt
cctcttcctaagatggtgtttggtcatggctggctgcttttagagggcggaaagatgtca
aagtcaaagggaaatgtagtggacccagtagtgcttgcgcaaaagtatggggttgatagc
ttaagatatttccttttgcgtgagattccatttggtgcagatgggtacttttcagaggat
gcattaaagacaaggcacaacagcgaccttgcaaacgatcttggaaatttattgtcaaga
acagttgcaatgattgaaaagtattttgatggaattatccatcttcctgaagtaaaagaa
gatcttgacaatgaactaataaccttggcaaaggaagtatacgaaaaagtgtgcaaatgc
cttgatgagcttcaattttcaaatgccttgatagaaatctggaagctgattgcaagggcg
aacaagtatatagatgagacaatgccgtgggtacttggcagggataaatctaagcatccg
cgcttgaaaacagttttgtacaacttagcagaggttttgaggattgttgcaatattgata
gaaccatttatgccacagacaacaccaaagatgcttgcccagcttggaatttcaaaagat
gaaaatcctgatataacatcttgggagtcagcggcaacttttgggctaattagagatggc
acaaaagtgaaaagagaccagccgcttttccccaggatagttgatgaaaaggaggagcaa
gaagtgcaagagcaaaataaaactgatgttaccaaaatagaaggtgctgttccggcagat
gacaaaaaagtagatgaaaagaaagagtatatttcaatagaagatttttcgaaaattgaa
ctcaaagttgccaagattttggaagcagaaaagattgaaggtgcagacaagctgcttaag
ctcattgttgacttaggtgatgagaaacgccagatagttgcaggcattgcaaaacactat
tcacccgaccagctcattggcaaaaagattgtggttgttgcaaacttaaagcctgcaaaa
ctgcgtggtgttgagtcgcagggcatgcttttggcagcatcaatcgatgatgagctttgc
ctaattactcctgaaaaagacatcaaagagggagcaagagtaaaatga

DBGET integrated database retrieval system