KEGG   Caldicellulosiruptor saccharolyticus: Csac_1089Help
Entry
Csac_1089         CDS       T00506                                 

Definition
(GenBank) Beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00460  Cyanoamino acid metabolism
csc00500  Starch and sucrose metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Csac_1089
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Csac_1089
Enzymes [BR:csc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Csac_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ABP66702
UniProt: A4XIG7
Position
complement(1235130..1236491)
Genome map
AA seq 453 aa AA seqDB search
MSFPKGFLWGAATASYQIEGAWNEDGKGESIWDRFTHQKRNILYGHNGDVACDHYHRFEE
DVSLMKELGLKAYRFSIAWTRIFPDGFGTVNQKGLEFYDRLINKLVENGIEPVVTLYHWD
LPQKLQDIGGWANPEIVNYYFDYAMLVINRYKDKVKKWITFNEPYCIAFLGYFHGIHAPG
IKDFKVAMDVVHSLMLSHFKVVKAVKENNIDVEVGITLNLTPVYLQTERLGYKVSEIERE
MVSLSSQLDNQLFLDPVLKGSYPQKLLDYLVQKDLLDSQKALSMQQEVKENFIFPDFLGI
NYYTRAVRLYDENSSWIFPIRWEHPAGEYTEMGWEVFPQGLFDLLIWIKESYPQIPIYIT
ENGAAYNDIVTEDGKVHDSKRIEYLKQHFEAARKAIENGVDLRGYFVWSLMDNFEWAMGY
TKRFGIIYVDYETQKRIKKDSFYFYQQYIKENS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcccaaaaggatttttgtggggtgctgcaactgcgtcatatcagattgaaggt
gcatggaacgaagatggaaaaggcgaatctatttgggacaggttcacacatcaaaaaaga
aatattctatacggtcataatggcgatgttgcctgcgaccattaccacaggttcgaagaa
gatgtttctcttatgaaagaacttggactcaaagcctacaggttttccattgcatggaca
agaatctttccagatggttttggtactgtgaatcagaaaggtcttgagttttatgataga
cttatcaacaaacttgttgaaaacggtattgaaccggttgtcaccctttaccactgggac
cttccgcagaagctgcaagacattggcggctgggcaaacccagaaattgtgaattattat
ttcgattatgcaatgcttgttataaaccgttataaagacaaagtaaaaaagtggataaca
ttcaatgaaccttattgcattgcttttttaggctactttcatggaatccatgcaccagga
ataaaagatttcaaagttgcaatggatgttgtgcacagcctcatgctttctcattttaag
gttgtaaaagctgtaaaagaaaacaatattgatgttgaggtgggaattacattaaattta
accccagtctaccttcagacagaacgacttggatataaggtaagcgaaattgaaagagaa
atggtttctttgagcagccagcttgacaaccaacttttccttgatccagtacttaaagga
agctatccacaaaagctgttagattatcttgttcaaaaagatttgttagatagccaaaaa
gcattgagcatgcagcaggaagtaaaagaaaatttcatcttccctgattttcttggtatc
aactattacacacgtgccgtcaggctttacgacgaaaattctagctggatatttccaata
agatgggaacatcctgcaggagaatacaccgagatgggctgggaagtgttcccgcagggg
cttttcgatcttttgatttggattaaagaaagttacccacaaattccaatttatataaca
gaaaacggtgctgcttataacgatattgtaactgaagatggaaaagtgcacgatagcaaa
aggattgagtatttaaaacagcactttgaagcagcaagaaaggcaattgaaaatggtgtg
gatttgcgaggctattttgtgtggtctttgatggacaattttgaatgggcaatgggttat
acaaaaaggtttggaattatatatgtggattatgaaacccaaaagagaatcaaaaaagac
agcttctatttttatcagcagtatataaaggaaaattcgtaa

DBGET integrated database retrieval system