KEGG   Caldicellulosiruptor saccharolyticus: Csac_1342Help
Entry
Csac_1342         CDS       T00506                                 

Definition
(GenBank) ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:csc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Csac_1342
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:csc03011]
    Csac_1342
Ribosome [BR:csc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Csac_1342
  Bacteria
    Csac_1342
  Archaea
    Csac_1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13
Motif
Other DBs
NCBI-ProteinID: ABP66944
UniProt: A4XJ59
Position
1511222..1511650
Genome map
AA seq 142 aa AA seqDB search
MKTYLAKPNEVPKKWYVIDATGKPLGRLAAKIAVILRGKHKPQFTPNVDTGDYVIVVNAE
KVVLTGKKLDKDGYRYHTKYPGGLKFIPYRRLLEKHPEKAIEIAVRGMLPKNRLRDRFMR
KLKVYRGPNHPHAAQKPEVLEI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaagacataccttgcaaagccaaatgaagttccaaagaagtggtatgtgatagatgca
acaggaaaaccgctgggaaggcttgcagctaaaattgctgtgattttgagaggaaaacat
aaaccccagtttacacctaatgttgacactggagactatgtaattgtggtaaatgctgag
aaggttgttttaacaggtaaaaagcttgacaaggatggatacagatatcatacaaagtat
cctgggggacttaagttcataccatatcgcagacttcttgaaaagcatccagaaaaggca
attgaaattgcggtgcgcggaatgcttcctaaaaataggctgagagataggttcatgaga
aagctaaaagtctacagaggaccaaatcatccacatgctgcacaaaagccagaagtgctg
gaaatttag

DBGET integrated database retrieval system