KEGG   Caldicellulosiruptor saccharolyticus: Csac_1814Help
Entry
Csac_1814         CDS       T00506                                 

Definition
(GenBank) Argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00220  Arginine biosynthesis
csc00250  Alanine, aspartate and glutamate metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01130  Biosynthesis of antibiotics
csc01230  Biosynthesis of amino acids
Module
csc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:csc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Csac_1814
   00220 Arginine biosynthesis
    Csac_1814
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csc04147]
    Csac_1814
Enzymes [BR:csc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     Csac_1814
Exosome [BR:csc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Csac_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC tRNA_Me_trans ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: ABP67399
UniProt: A4XKG4
Position
complement(1957402..1958619)
Genome map
AA seq 405 aa AA seqDB search
MQLNKVVLAYSGGLDTSVIIPWLKENFSCEVIAVVVDVGQEDDFETIKERAYKTGASKVY
IEDAKAEFVKEYIFPTLKAGAVYEGKYLLGTSMARPLIAKRLVEIAKKENADAIAHGATG
KGNDQVRFEVTIKALMPNIKIIAPWRMWNLKSREDELNYLAQKGIDIPFKKEESYSTDWN
IWHLSHEGLELEDPWNMPNFEKVLMIIKNPFSLNDEPETIEIEFEKGVPIKINGKEMNCV
ELLKYLNKKGAEHGIGIVDIVENRLVGMKSRGVYETPGGTILHYAHRELEYLCLDRATLH
FKEMVAIRFAELVYDGLWFSPLREALSAFVDKTQEVVNGTVKLVLYRGNIYSAGSKSPNS
LYIKDLATFEEDQMYNQKDAEGFINLFGLPLKVFGMVNKKAGDSD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaacaaagtagtccttgcttattcaggcgggcttgatacatctgttataata
ccatggctaaaagaaaacttcagctgtgaggtcattgcagttgtagtggatgttggccaa
gaagatgactttgagaccataaaagaaagagcctataaaactggtgcatcaaaggtttat
attgaagatgccaaagcggaatttgtaaaggaatatatattccctactctaaaagctggt
gcagtttatgaaggaaaatatcttcttggcacgtcaatggcaagaccgctaattgcaaaa
aggcttgttgagattgctaaaaaggaaaatgctgatgcaatagctcacggtgccacaggc
aaaggtaatgaccaggtaagatttgaggtgacaataaaggcacttatgccaaatataaaa
ataattgctccttggagaatgtggaacttaaaatcacgtgaagacgagttaaattacctt
gcccaaaaaggaatagatattcctttcaaaaaagaagaaagttacagtactgattggaat
atatggcacctgtcgcatgaaggacttgagttggaagatccctggaacatgcctaatttt
gaaaaagtgttaatgattataaaaaatcctttttcattaaatgatgagccagaaactata
gaaatagagtttgaaaaaggtgttccgattaagataaatggcaaagaaatgaattgtgtt
gaacttttgaagtatttaaataaaaaaggagcagaacatggaattggcattgttgacata
gttgaaaataggcttgtgggaatgaaatcgcgtggcgtgtatgaaacacctggcgggaca
atcttgcactatgctcatagagaattagaatatctttgccttgacagagcaactttacac
tttaaagagatggtagctatcagatttgctgaacttgtttatgatgggctttggttctca
cctttaagagaagcactttcagcatttgttgacaaaacccaagaagttgtaaatggtaca
gtaaaacttgtgttgtacagaggtaatatttactctgctggttcaaaatcaccaaattca
ctgtacatcaaagaccttgcaacatttgaagaagaccagatgtataatcaaaaagatgca
gaaggatttataaacttgtttggcttacctttgaaggtattcggaatggtgaacaagaag
gcgggtgattcagattaa

DBGET integrated database retrieval system