KEGG   Caldicellulosiruptor saccharolyticus: Csac_2248Help
Entry
Csac_2248         CDS       T00506                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00020  Citrate cycle (TCA cycle)
csc00620  Pyruvate metabolism
csc00633  Nitrotoluene degradation
csc00640  Propanoate metabolism
csc00650  Butanoate metabolism
csc00680  Methane metabolism
csc01100  Metabolic pathways
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
Module
csc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_2248
   00020 Citrate cycle (TCA cycle)
    Csac_2248
   00620 Pyruvate metabolism
    Csac_2248
   00640 Propanoate metabolism
    Csac_2248
   00650 Butanoate metabolism
    Csac_2248
  Energy metabolism
   00680 Methane metabolism
    Csac_2248
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Csac_2248
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Csac_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_C Transketolase_C Hydrolase
Motif
Other DBs
NCBI-ProteinID: ABP67826
UniProt: A4XLP1
Position
complement(2380413..2382620)
Genome map
AA seq 735 aa AA seqDB search
MIKPQETIFESGNEMAALAASQINYHIMGYYPITPSTQIAEELDQMRADGQHDILLIAAD
GEHGAAGICYGASLGGGRVFNATSANGLMYALEQLPVQSGTRFPMVLNLVTRSISGPLDI
KGDHSDLMFTLNTGWIILLAKDPQRVYDMNIMAVKISEHPEVNLPVIVAYDGFFTSHQKR
VVSYFKNKEDVLEFVGKTPPPRIVATDPENPVTIGPYMNEPDLINNKYQLSKAMDKAYEV
IPQVFDEFYEISGRKYTLVEGYKMEDAEVAIFVLNSSYDTVCEAVDLLRQKGLKVGVATT
NVLRPWPKKEIQELLKNVKYLTVLDRQESYGAKGGNMTIEVKATLQELRADIKVISRIYG
LGGKDFFLDDAISIFEDLYLAYEGKKQISDFDYIGAYAGDENYKPKKYMEPIKAEWTKNI
ALNTRDLTAMPKRIVPGHGACPGCGIFPNLNLLLKGIEGDVVLLFHTGCGMVVTTAYPQT
AFRTTYIHNLFQNGAATLSGLVEMYHQRQKRGEIPNRELTFILVTGDGGNDIGMGPTIGA
ALRNHKMIIFEYDNGGYMNTGYQLSYTTPYGASSSTSHVGKTQFGKSTFHKDTPQIMAAT
NIPYVATVAESDPIDFVKKARKAQKIMREEGLVYIKALSACPLNWGDEPSKERRVIKAAV
DCCFHPLYEVDHGKTIITYDPEKKGKKIPVIEWLSMMGRTRHLTRPEYKHIIDEFQKEID
RRWERLKAKHEHPLL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacctcaagaaacaatttttgaaagcggaaatgaaatggcggctttggctgca
tcgcagataaattatcatatcatgggatattaccctataacgccatcaacccaaattgca
gaagaacttgaccagatgagagcagatggtcagcatgatatcttgcttattgcagcagat
ggcgagcatggggcagcaggaatttgctacggtgcaagtttaggcggtggaagagttttt
aatgcaacaagtgccaatggtcttatgtatgcattagagcagctgcctgttcaatctggt
acaagatttccaatggttttgaatttagtcacaaggtcaatttctggacctttagatata
aaaggtgatcatagtgacctgatgtttacattaaatactgggtggataatcttgctggca
aaagatcctcaaagggtttatgacatgaatatcatggcagtaaagattagcgaacatcct
gaggttaatttgcctgttattgttgcgtatgatggattttttacaagtcatcaaaaaaga
gttgtaagttattttaagaacaaagaagatgttctggagtttgtaggcaaaactccacca
ccacggattgttgcaacagaccctgaaaatcctgtgacaattggtccatacatgaatgaa
cctgaccttataaataacaaatatcaacttagcaaggcgatggacaaagcttatgaggtc
atccctcaggtatttgatgaattttatgaaataagtggtagaaaatatactttggttgaa
ggttacaaaatggaagatgctgaggttgcaatattcgtgttgaattccagttatgatact
gtttgcgaagctgttgaccttttaaggcagaagggtctcaaagttggtgtggcaacaacg
aacgtgttgcggccctggcctaaaaaagaaatccaagagctgctcaaaaatgtaaaatac
cttactgtattagatagacaagaaagttatggtgcaaaaggtggcaatatgacaattgag
gtaaaagctactctacaagagttaagggcagatataaaagtaattagcaggatttatgga
cttggtggcaaagacttctttttagatgatgccatttctatttttgaagatttgtattta
gcatacgagggtaaaaaacagatatcagattttgattatatcggagcatatgcaggagat
gagaactataagcccaaaaaatacatggagccaataaaggctgagtggacaaaaaatatt
gcattaaatactcgcgacttgacagcaatgcccaaacgaattgttcctgggcatggggca
tgtccaggatgtggaatctttccaaacttgaatctccttttaaaaggtattgaaggggat
gtagttttactttttcatacaggctgtggtatggttgtaacaactgcttatcctcaaaca
gcatttagaacaacttatatccacaatctatttcaaaatggggctgctactttatcggga
cttgtagaaatgtatcatcaacgtcagaaaagaggggagatacccaatagagagttaact
ttcatacttgtaacaggtgatggcgggaacgacataggtatggggccaacaattggagct
gctctgagaaatcacaagatgattatatttgaatacgacaatggtggatatatgaatact
ggttatcaactttcatatacaactccctatggagcctcaagttcaacttcacatgttggc
aaaactcagtttggaaagtcaacattccataaagataccccacagataatggctgcaaca
aatattccatacgtggctactgttgctgagtcagatcccatagattttgtaaaaaaagca
agaaaggcacaaaagattatgagagaagagggacttgtttacattaaagctctgtcagca
tgtccactgaactggggagatgaaccatctaaagaaagaagagtaattaaagcagctgtt
gattgttgtttccatccactttacgaagttgatcatggcaaaactattatcacttatgac
cctgagaaaaaagggaaaaagattcctgttattgagtggttatctatgatgggaagaaca
aggcatcttacaagacctgaatataaacatattatagacgaattccaaaaagaaattgac
agaagatgggaaaggctcaaggcaaaacatgaacacccccttctatag

DBGET integrated database retrieval system