KEGG   Clostridium scindens: HDCHBGLK_02476
Entry
HDCHBGLK_02476    CDS       T06591                                 

Gene name
cdhC
Definition
(GenBank) Caffeine dehydrogenase subunit gamma
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
csci  Clostridium scindens
Pathway
csci00230  Purine metabolism
csci01100  Metabolic pathways
csci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HDCHBGLK_02476 (cdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: QBF75067
UniProt: B0NHD6
Position
2417553..2418041
AA seq 162 aa
MSDRQFKRIHCIINGREVETMIDVRASLTDLLRNDFRLTSVKKGCEVGECGACNVIIDGE
CFNSCIYLAAWADGKNIRTLESLMGPDGELSDIQQAFIDETAVQCGFCTPGFIMSAVEIL
ESGKEYSREELKKMLSGHLCRCTGYENIINAVEKTMKKRLGI
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagtgacaggcagtttaaaagaattcattgtatcattaacgggagagaagtggaaacc
atgatagatgtccgcgcttcgctgacagaccttcttcgcaatgatttccgacttaccagc
gtaaagaaaggatgcgaagtgggcgaatgcggggcctgcaacgtgatcatagacggcgag
tgctttaattcctgcatctatctggctgcgtgggcggacggaaagaatatccgtacgctg
gagagcctgatggggcctgatggggaactatctgacatccagcaggcatttatcgatgag
acggctgtacagtgcggcttctgtacgccgggctttatcatgagcgcggtggagatcctg
gagtcaggaaaggaatattcaagagaagaattaaaaaaaatgctttccgggcatctatgc
cggtgcacaggttatgaaaacattatcaatgcagtggaaaagacgatgaaaaaaaggctg
ggcatttaa

DBGET integrated database retrieval system