KEGG   Centruroides sculpturatus (bark scorpion): 111614571Help
Entry
111614571         CDS       T06064                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial-like
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00640  Propanoate metabolism
cscu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    111614571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 111614571
NCBI-ProteinID: XP_023211711
Position
Unknown
AA seq 101 aa AA seqDB search
MLVKLKMDEPEECKIGIMPGHIHQAGKIGIVSRSGTLTYEAVHQTTAVGLGQSLCIGIGG
DPFNGTDFIDCLEIFLNDPDTKAGDVAFSNMYIFIISNKSY
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgttggtaaagctgaagatggacgagcctgaagagtgcaagattggcattatgccagga
catattcatcaggcaggtaaaataggaatagtatcaagatcaggaacattaacatatgaa
gcagtacatcagactacagcagtgggattagggcagtcactttgcattggtattggagga
gatccttttaatggaactgattttattgattgcttagaaatatttctcaatgatcctgat
actaaagctggagatgttgcttttagtaatatgtatatattcatcatatctaataaatca
tattag

DBGET integrated database retrieval system