KEGG   Centruroides sculpturatus (bark scorpion): 111615088Help
Entry
111615088         CDS       T06064                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00071  Fatty acid degradation
cscu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111615088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cscu03029]
    111615088
Enzymes [BR:cscu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111615088
Mitochondrial biogenesis [BR:cscu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111615088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf FANCI_S3
Motif
Other DBs
NCBI-GeneID: 111615088
NCBI-ProteinID: XP_023212244
Position
Unknown
AA seq 269 aa AA seqDB search
MISNYFKKPKQIYLGIPTFVKLLDLRSTSLCFFINRNEKNSIRNGMWPTSLSNLTIACTV
LLFLMLTEPGFTYSINSWLWKLSYILHIPQKFPRTLRAAVTSGIVGFIFFIVLMNIRQYL
LRILLSYRGWMYEPLHASSKLTLLWCAVVRLISGYQPSLYSCQRSLPRMPVPAINDTIQR
LLESLKAVCTEEEFQEIEKQAKVIINMIEILQKSIFVKSELSSQSYVKILWEKYAYLKSR
SPLPNNSNYYVCDQSYWTPATTQISSMDY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgatatcaaattattttaaaaaaccaaaacaaatttacctgggaattcctacatttgtc
aagttgttagatttgagaagtacaagcttatgcttctttatcaatagaaatgaaaagaat
tcaattcgcaatggcatgtggccaacatctctgtcaaatctcactattgcctgtacagtt
ttattatttcttatgttaacagaaccaggtttcacatattctataaattcttggctttgg
aaattaagttatattttgcacattccacaaaaatttccaagaacattaagggcagcagtt
acatctggtatagttggatttatttttttcattgtattgatgaatattcgccagtattta
ttgagaattctactttcatatcgtggttggatgtatgaaccattacatgctagttcaaag
cttacacttttatggtgtgcagtggttagacttattagtggctatcaaccttctttatat
agttgccagagatctctaccccgaatgccagttcctgcaattaatgatacaattcaaaga
ttattagaatcattgaaagcggtttgtactgaagaagaatttcaagagatagagaaacaa
gctaaagtaattataaatatgattgaaatattacaaaaatctatatttgtgaaaagcgaa
ttatcttctcaaagttatgtaaaaattttgtgggaaaaatatgcatatttgaaaagtcga
agtcctctaccaaataacagcaattattatgtttgtgatcaaagttattggacacctgct
accactcaaatatcaagtatggattattag

DBGET integrated database retrieval system