KEGG   Centruroides sculpturatus (bark scorpion): 111621680Help
Entry
111621680         CDS       T06064                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like isoform X1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00230  Purine metabolism
cscu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111621680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cscu01001]
    111621680
Enzymes [BR:cscu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     111621680
Protein kinases [BR:cscu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   111621680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Comm FAM163
Motif
Other DBs
NCBI-GeneID: 111621680
NCBI-ProteinID: XP_023219656
Position
Unknown
AA seq 1082 aa AA seqDB search
MLRLVNISFLVLALMKSFSTEESEIIKFDRSSNDTVRVAVILPKSPSYLASIIRVTPAIR
LAIDKVRNQQVLPGWKWDVHYLDSQCSSTYGPMHAVRAYIEDRIHLFLGPVCDYVTAPVG
RLLKFWDVPLLTSGALARDYGLNKSHFDNEYYLLTRVGLSFNDAVSFLLEIFKQFTWRKL
LLFYDSQARSEISSEDYCMLWTKAIISELRISENYVWQHYKLPSKLDERLATQILLNEVG
TEFGVIVVCASPDVVRNIMLAADSIGMIDIGEYVFFSLELFSSRKEILRPWYRENESFEK
NKRAEHAYKALFTLTSLNPTTKKFEDFTKSVKHVAKEEFGFDYKEEEVNKFVSGFYEAII
LYSLSLNETLSEGYSITNGSIITQKMWNRTFQGITGPVSINENGDRNANYTLMNLNPHKR
IYQAVAMYDGANKRYLEFNETKYYWPGKRKGPPYDTPICGFDRSKCLNRDVPQYAIVSVI
LLCVIVALCICSIFIYRHFKLEAEIASMTWRIKWEDLILISPTHAKHLGSKISLTRISMQ
SNCSSITMDAADMSKQLFARTGYFKGSIIAIKPILLSRIDITRPLLYELKYMKDLQHNHL
VRFIGSCIDSPHCCLITEYCPKGSLQDILENNEIKLDWMFQCSLMHDIIKGMAYLHSSEI
HSHGNLKSSNCVVDSRFVLKITDFGLHSLRTYDENENEDSYAHWRRKLWMAPELLRKSKP
PPEGTQKGDVYSFAVVAHEIVMRQGPFYLGTVELSPKEIVENVKNKQKQPFRPYLGEYIC
EEGRKMIARCWSEDPFDRPDFQYLKSVIRKLNRENENGNILDNLLSRMEQYANNLEALVE
ERTADYLEEKRKAEDLLYQLLPKTVANQLILGEGVAAEAYDNVTIYFSDIVGFTALSAQS
TPMQVVDFLNDLYTCFDSIIENYDVYKVETIGDAYMVVSGLPTKNGNKHVREIARMSLAL
LNTVKTFPIKHIPEEKLKLRIGIHTGPCAAGIVGLKMPRYCLFGDTVNTASRMESTGLPL
KIHVSSQTKEALDMFGCFNIELRGEVEMKGKGKLVTYWLLGEHFPVHYEEAERRNHGCFL
TE
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgcttagattagttaacatatcattcctagtattggctttaatgaaaagtttctccaca
gaagaatcggaaattatcaaattcgaccgatcatccaacgacactgtaagagttgctgtc
atattaccaaaatctccttcatacttagcttctataatacgagttacaccggcaattcgt
ttagcaattgataaagttcgtaatcaacaagttttacctggatggaaatgggatgtgcat
tatttggattcgcagtgtagcagtacttacgggcccatgcatgctgttagagcatatata
gaagacagaattcatttgtttctagggcccgtttgcgattacgtaactgccccagtgggt
agacttttgaaattttgggacgtacctcttctaactagtggtgcgttggcacgagattat
ggcctcaacaaatctcatttcgataatgaatattaccttttaactagagttggattgtct
tttaatgacgccgtgtcgtttctattagaaattttcaaacagttcacttggaggaaatta
ttacttttttacgattcccaagcaaggtctgaaatatcaagcgaagattattgtatgcta
tggactaaagccatcatttctgagttaagaatatctgaaaattacgtttggcagcattat
aaattgcctagcaaattagacgaaaggctagcgactcagatactactaaacgaagttggg
accgaatttggtgtgattgtagtttgcgcttccccagacgttgtaaggaatatcatgctg
gctgctgatagtataggtatgatagacattggtgaatatgtattcttctctctggaatta
ttcagtagtagaaaagaaatattaaggccgtggtatcgagaaaatgaaagttttgagaag
aataaaagagcagaacatgcttataaagcgttatttactttaacatcgttgaatccgaca
acgaaaaagtttgaagattttactaagtccgtaaaacatgtagcaaaagaagagtttgga
tttgattacaaggaagaagaggtaaataaatttgtatctggattttacgaagcaataata
ctctactccctttctttaaatgagacattatctgaaggatatagcattacaaatgggtct
atcatcacgcagaaaatgtggaatagaacatttcaaggaataactggaccagttagtatt
aatgaaaacggcgatagaaatgcaaattatactttaatgaatttaaatccgcataaaaga
atatatcaggcagttgcaatgtacgatggtgctaataaacgatatttagaattcaatgaa
acaaagtattactggcctggaaaaagaaaaggtcctccttatgatacacctatttgtgga
tttgaccgttccaagtgcctaaatcgagatgtccctcaatatgccatcgttagtgttatt
ttattgtgcgtgattgttgcgctttgtatctgctcgattttcatttatagacacttcaaa
ttggaagcagagattgcttcgatgacttggagaataaagtgggaagatttaattctaatt
tcgccaactcatgccaaacatcttggatcgaagataagtttaacgaggataagtatgcag
agtaattgttcgtcaattacaatggatgctgctgatatgtcaaaacagttatttgcaaga
actggttattttaagggaagcataattgctattaagccaatactgctatcaagaatagat
ataacccgtcctttattatatgaattgaaatatatgaaagatcttcagcacaatcatctt
gtacgatttattggctcgtgtattgattcaccgcattgttgtttgataacagaatattgc
cctaaaggaagcttacaagatatattagaaaataacgaaataaaattagattggatgttt
caatgttcattaatgcacgatattattaagggtatggcttatctacatagtagcgaaatt
cattcgcatggtaatttaaaatcatcaaattgtgttgtggacagtagatttgtcttaaaa
ataacggattttggtcttcattctttaagaacatacgacgagaatgaaaacgaagattct
tacgctcactggagaaggaaactttggatggctccagaattacttcgaaaatcaaaacct
cctcctgaaggcactcagaaaggagatgtatattcctttgctgtcgtcgcgcacgaaata
gtgatgagacaaggtcctttctatctaggtacggtagaactgagcccaaaagaaattgtc
gaaaatgtaaaaaataaacagaagcaaccatttcgtccatatttaggagaatatatttgc
gaagaaggacgtaaaatgattgcgagatgttggtctgaagatcctttcgacagacctgat
ttccagtatttaaaatcagtgataagaaaattaaatagagagaatgaaaatggtaacatc
ttggataatcttctctcaagaatggagcagtatgcaaataatttagaagctcttgtagaa
gaaagaaccgcagattatttagaagaaaagagaaaagccgaggacctactttatcaactc
ttgcctaaaacagttgcaaatcaattaatattaggagaaggtgttgcagctgaagcttac
gacaacgtaacaatatattttagcgatattgttggttttactgcactttctgcacagagt
acaccaatgcaggttgttgactttctcaacgatctttatacttgttttgattcgattata
gagaattatgatgtatataaggtagaaacaataggagatgcttatatggtagtttctggc
cttccaacgaagaatggaaacaaacatgttcgtgaaattgccaggatgtccttagcttta
ttgaatacagtgaaaacctttcctataaaacatataccagaagaaaaattaaaactaaga
attggaattcatacaggtccttgtgctgctggaattgttggattaaaaatgccaaggtat
tgtttatttggtgacacggtcaatacagcatccagaatggaatcaacaggcttaccatta
aaaatacacgttagttcacaaacaaaagaagcattggacatgtttggatgttttaatatt
gagctaagaggagaagttgaaatgaagggaaaaggaaagttggtaacctattggctgtta
ggagaacattttcctgttcattacgaagaagctgaacggagaaatcatggatgtttctta
accgaataa

DBGET integrated database retrieval system