KEGG   Centruroides sculpturatus (bark scorpion): 111626149Help
Entry
111626149         CDS       T06064                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cscu01001]
    111626149
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cscu04131]
    111626149
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cscu04812]
    111626149
   04147 Exosome [BR:cscu04147]
    111626149
Enzymes [BR:cscu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111626149
Protein kinases [BR:cscu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111626149
Membrane trafficking [BR:cscu04131]
 Others
  Actin-binding proteins
   Others
    111626149
Cytoskeleton proteins [BR:cscu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111626149
Exosome [BR:cscu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111626149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set Ig_6 Ig_C17orf99 Ig_5 C2-set_2 C1-set Interfer-bind V-set_CD47 Ig_4 Pur_ac_phosph_N fn3_2 Adeno_E3_CR1 V-set_2
Motif
Other DBs
NCBI-GeneID: 111626149
NCBI-ProteinID: XP_023225217
Position
Unknown
AA seq 5372 aa AA seqDB search
MFSEKSCIVILVSMIIIQILAESPKIQPFNFESVIRTGGKTTVTCAVKRGDFPLEFSWNK
DGKDIDKLENIKISSLKEFSVIVIDPVLSESGGNYTCNVKNYHGSDSYTALLTIEDPPSW
LIEPKDIETPADSDVILQCSGNSSPKPKINWWKISDINEKQELISSDGILRLSKITTNDS
GRYLCTISNGVGKALNKEIVLTVLVPAKFEEKFAVVSSRRGDSTSLKCEATGDQPLSIVW
KKDMVELGKSGGNRYEIFETLTAKGLKSELIIRETERTDSSMYSCAAENPYGKDDRNMKL
LVLEVPARPLNVKVHDVWSRSVSVSWSPPYTGNSPITQYVVQYWRDQGAPHRLQEKDVTS
SQTSTLIKELNPGTTYTLSVVAENAVGRGESSQTVTFTTGEEEPSGAPIDVNVEAKGSSS
LFVSWKDPPRSDWNGLLKGYYVGYKVLDSAQPYSFKTLEYSQSAIHEHMITNLRKDTEYK
IVVKAFNAAGSGPVSQDVLVKTLGGDLPLPPHIFLASTTDSSIKVQWHPQDTRTPLTGHV
IHYRKKFERWQQIPVLTPSENVFTINGLESGAEYQLYVTSANEFGEGDPSELLNVKTTGH
SNDNLILLTGGQDAPYYLDLSLLVPIAASVAAIIVVTIVVCIWVQKARGRRNLERALREE
KHYNYGPASQRYVDIEKSRQYPYPDSDLSSNYPTPYATVPMRDDVSESGNDPHQEMKSFL
PQNMKDRPLPVPKTSSLKKKDESHIYDNGDMPIIRPFSLPRDLKIGDKVSILCSVSSGQQ
PLTFHWIKDGEEMFETKNIKIHSHSDVSVITIHSINENSVGNYTCFVSNNFGTTFHTAVL
EVPVSPSWKIEPNSLDVVVGQNASLHCEANGFPVPTISWIKQENSFGEKENLVMDHKFIM
NSTLLLIHVKKEDGGIYECSAKNGIGIGLKKAVSLIIKDYVCTVSPKIRPFAFPQDLKMG
DRVSVICSASSGTRPLTFQWKKDTDTLVEGKNTEIHFHTDLSVLAIDSITDQNNGNYTCI
VSNLAGTTSYSTILTVSAPPEWKQEPHDTESVIGSNITIRCQAYGFPLPTIQWQRRENPF
HHSDKRVGSLKENYLITSDGTLIITNIQKEDEGILECVAKNGIGKELKKSVTLSVKAINP
INSNSSGNYSCVVSNKFGTTSYTAILEVPVPPIWKQEPQNIESIIGNNVTIACQANGYPP
PTVTWTNKVTVEGNLIITNIQKEQEGIMECSARNGIGELKKIITITVKEPPGINPFNFPS
NLKIGGRVSVICAVISGSKPFKIWWEKESRTIKEDKHITIHIHAVESVLRIDPITVESSG
NYSCIVSNEFGTTRHNAVLEIPMSPTWILEPKNTDIVVGNNITIQCQAHGFPIPNLSWSR
KDIPKIAPFSFPPNLKIGDIGSVTCSVTSGSRPLKFQWKKDHIDINENTNVAVLTHSDLS
AVSIKSIKEENIGNYTCTVSNKYGSNSYMTRLEVPIPPTWKIEPKDIEIVKDDNVTIKCE
ANGFPTPKMEWTKKYGDMPIIRPFSLPRDLKIGDKVSILCSVSSGQQPLTFHWIKDGEEM
FETKNIKIHSHSDVSVITIHSINENSVGNYTCFVSNNFGTTFHTAVLEVPVSPSWKIEPN
SLDVVVGQNASLHCEANGFPVPTISWIKQENSFGEKENLVMDHKFIMNSTLLLIHVKKED
GGIYECSAKNGIGIGLKKAVSLIIKVSPKIRPFSFPQDLKMGDRVSVTCSVSSGTRPLTF
QWKKDADILLDGKNIEILFHTDLTVLAIDSITDQNNGNYTCIVSNLVGTTSYSAILIVSA
PPEWKQEPHDTESVIGNNITIRCQAYGFPLPTIQWRKKETLFHHLDKSMETLKENYQITL
DGTLIITNIQKEDEGILECIAKNGIGKELKKSVTLSVKVPPIWKQEPQNIESIIGNNVTV
ACQAYGYPPPTVTWTNKVTVEGNLIITNIQKEQEGIMECSARNGIGELKKIITITVKEPP
GINPFNFPSNLKIGGRVSVICAVISGSKPFKIWWEKESRTIKEDKHITIHIHAVESVLRI
DPITVESSGNYSCIVSNEFGTTRHNAVLEIPMSPTWILEPKNTDIVVGNNITIQCQAHGF
PIPNLSWSRKEDEGIYECTAINILGTTLQKTITVIVKDLPVIAPFNFPQTIKVGNRISAM
CTATSGDQPFVFNWKKDQEDISENSVIKIITANHISVISIDSVSSENAGNYTCIVSNAVG
TASHTATLIVPISPSWEKEPKNVEVVVDTNVTIECQASGYPKPSITWNIKENSFGEKENL
VMDHKFIMNSTLLLIHVKKEDGGIYECLAKNNLGEIRKAITVTVKELPVIKPFTFPDNLK
TGDSLSVSCSVISGDKPLTFMWMKENKEIKDGSNAKIHTHTSLSILAIDPLDEQNRGNYT
CIVSNAFGSTSHTANLQIPVPPSWIEEPKNSEAVANGNITILCQASGYPKPTITWVRKEG
PFDSSVSMDNKEIKDNEKLTFVKISKNDEGLYECSAYNGIGTSLKKTITLSVKESPKIQP
FHFPSEVKMGSKISIGCFALGKKPLTFNWLKNNQNVKDISGIHLKTDEEFSVLTIEPVDL
KSIGNYTCLVQNSIGEDKFTAQLRVKKNDYSTNNVQKSENGTFYITNVDIKHSGNYVCEA
DNGIPPSLRKIITVIVHVMFLDTPVIQPFSFPDNIIAGKSISIFCTVTDGIKPITFSWLK
NNVVLTSDEDIKINNHDLYSALIIDHVDVRHKGNYTCKVKNKIGSDSHTAFFDIKVPPRW
ITEPMDHSIIFGSNHYLDCKVFGFPPPQVKWLKLDDSSENTPILAAESDRWTVLKNGTII
ITNVKKEDSGTYMCQADNKFGNTLKKIIKIDVFVPARFEEKYSTVTSKKGDSARLRCDAI
GDQPLSITWKKGPLQLSKSRNARYEVFETLTSEGLQSELVIRETKRDDGSIYICIAENTY
GSDERKVKLSILEVPGRPQNVKIAERWSRSATVVWSVPYTGNSPITKYIVQYWREKGAPH
RLHEHPISSLQTSTMIDKLHPGTSYVVNVVAENSVGRGEASKPVRFHTGEEEPSLPPVDV
SIEQKGPTTIKVTWKPPPLDSWNGQLKGYYIGYKIRAAPIAQSYNFKFVEYGGERTQEYL
LTKLMKGTEYCIVVQAYNSAGSGPPCHEMIERTTDADVPHSPFLSLMSVTVSSISVNWLA
KHSKTPLTGFILHYRRGFNSWKETSLIPANEKQYTLSNLDSGTFYELYLTAANQAGKSDP
SDTLRVRTDFVEGYKLSSVIDKTVWNPPYFQISVLIPIAACLTSIFVAIIVACVCVRKLK
NERRKRGLMEDKQSNYGGTIQRYVDVEKNRPLVNNECSMSSLYPAPYATIPMRDDPEGDF
AKSGMDHEMKTFVQQNHIERPIPPPRPSSLKKKIELRATKGGISRAGVHVWYYSPKIQPF
NFPRHIRVGQKATVTCLVLFSDESLSFTWTKDGKTVPDNSEIRIKHEKDYSVIIVDPVKI
QSQGNYTCKVNGNFGSDAYTTELFVEDAPTWREEPQDQIAILGNELELRCKANGSPKPQI
LWKKLKMKIIPITDYEYAFNIDIQVLLFNNTNIFSPRYSNVRYNFYLFVDPLKIEPFNFR
RVPIGETTTALCAVTSKTKHVSFTWLKNGETINKSDEIKIKHDLDYSVIKIDSVKLDSRG
NYTCVVRSGTYVNSFTAQLEVEASPSWLEEPFDITNMLGEPMHLHCRASGSPEPKIIWRR
FEDNSNSKLLSSNKNGSVLIKETNEKDQGIYQCEADNGIMPSIKKNISVKIYDNQGNYTC
VVTNNFGSDSYTAQLLVEAPPQWAEEPKDAIMIAGETVSIHCQATGSPKPLVTWKKLEGK
TPKNILNGKLTPISVDNGTLIFKNASAELSGLYECEASNSIGQAIKKTIELTVKVPARFE
EKFTVITARKGESSKIRCEAIGDQPVSIVWSKEDIKLNKAGGTRYEIFETLLPKGMVSEL
IIRSSDREDGALYTCVTENQYGHDQRKIRLLVMEVPAPPLDLKVREVWSRSCSISWSSPY
SGNSPITKYIIQYWRDQGSGNRLYEKEVPSSQSNALIKDLHPGTSYMLKVVAENTVGRGD
PSASVVFHTGEEEPSSPPVDISVESGGSSTIKVTWKPPPRDNWNGNLKGYYIGYKSRDST
QPYSYKTVEYVPNRTQEYFLTNLLKATDYSVIVKAFNSAGGGPASHEVIVKTLDGDLPSP
PSVYVLSTSPTSITLRRNSKRSDTAVTGYTIYYKEEEEGEWQEVPITSIDDNTYVLNDLN
IGKTYQLYITASNQYGRGDPSEIIAARTVDRALLAVVGGAHPPYLDLAVLVPVAVSLLTI
VIVITVACICVRKIRKRQHIERALAAEKHLSLPGTMQRYVDVDKARPLVQVDPSIQENYP
SPYATMPMMDESEINYSKECLNQELKTFFPQDRPVYPKPSSLKRRDDHIYDMVEIQPFSF
PKNIDEGQRVQTTCAIRKGKGDLSFSWKKDGQPIESNTMWTIYSHEMASMFMINNASVES
TGNYTCMVRSASSEDAYTAALIVTGPPKWLKEPADLAVAAGDNATLECQAYGNPDTSFTW
KRSRDDKKTWHDIEDGHMKIEAKGTLTFYNIRVTDAGYYNCEVTNGLGTLQKTIVLKVKE
IPKIQPFFFPKNLTAGKTVKVICNPSEGSVPFTFEWLKDGTQVVPSTHVAVKTHEDYSLL
NIDSVSWEDAGNYSCVLNNSAGSDTFTATLSVFASPVWLKEPQDTSVANEGMVVIDCIAA
GYPQPIIKWRRLQGRVSTVLKSEGRYFLASNGSLIIRPSQLNDSGSYECRASNGMANDLI
RTISLTVHVAARFEQKFAVHTVKLAETAKLRCDAVGDNPTTITWTYNHQSITQHQSSRYE
IFESITDKGTTSELHIHDADRGDNGQYVCVAKNSYGKDERTVKLVVLEVPGSPSDVRTEQ
TWSQSASVRWTSPYNGNSAITQFIIQYWKDSGTSHRLEEETVSPTQNTMTLHNLHPGTAY
IVRVLATNEIGRGSPSESVQFITKEAAPSAPPTDVSVDAKGAGALTIKWKAPPRDQWNGL
LKGYYVGYKIQGTSDSYTYKTVDFNKHLEEEYRLSGLKKATEYSVVVQVFNNAGSSPPSH
EIIVKTSEKDPPLPPYLWLESRSRSSISLKWDHKSKEEQQEIHYILFYREESGTWTELAV
PRDSHNQYSLTNLREGTRYQLYLKAYSEAGQSDSSEMLSVKTEGGALSDSSSYPIHEREN
DTPVYLRETVIAPIGVSVAIVLLVVFGACLYVRREEKKYRAALASVTDKRYPYGGNHTLP
HMSSQRYVDVDKSRPLIRSPLPPPPPSASDTYPAYPAPYATLPLRGGTLDRRRFSEDQQR
ATFLAQHTLDRKRSTGHVIQETAEVHHYDMAA
NT seq 16119 nt NT seq  +upstreamnt  +downstreamnt
atgttcagtgagaaaagctgtatagtgatcttagtctcaatgattattattcagattcta
gcagaatctcccaaaattcaaccatttaattttgaatcggtgatacgaactggagggaag
acaacagtaacttgtgctgttaaaagaggagactttcctttagaattttcgtggaataaa
gatgggaaagatattgataaattagaaaatattaaaattagttctcttaaagaattttcc
gtaattgtaattgatccagttctctcagagagtggaggtaattatacatgtaacgtgaag
aattatcacggcagtgatagctatactgcattattaacaattgaagatcctccgtcatgg
ttaatcgaacctaaagacattgaaacacctgctgatagcgatgtaatattacaatgcagt
ggaaacagttctcctaagccaaaaattaattggtggaaaatatctgatataaacgaaaag
caagaattaatatcttccgatggaatattaagattatccaaaatcacaacaaatgacagt
ggaagatacttatgcacaatatcaaatggtgtggggaaagctcttaataaagaaatagtt
ttaactgttcttgtaccagccaaatttgaagaaaagtttgctgttgtgtcatcgagaagg
ggagatagtacaagcttaaaatgcgaagcaacaggagatcaaccattatctatcgtatgg
aaaaaagatatggtggagttgggtaaaagtggtggaaatagatatgaaatatttgagacg
ttaactgctaaaggtttgaaatcggaattaataataagagaaaccgaaaggacggatagt
tcaatgtattcctgtgctgcagaaaatccttacggaaaagatgatagaaacatgaaattg
ctggttcttgaagttccggcgcgaccgcttaatgttaaagttcatgacgtttggagtaga
agcgttagtgttagttggtctcccccgtatacaggaaatagcccgataactcaatatgtg
gtacagtattggcgagatcaaggtgcaccacatcgtctacaagaaaaagatgttactagt
tctcagacatcaacacttattaaagaattaaatcccggaaccacttatacattaagtgtt
gttgctgaaaatgccgttggacgaggtgaatcttctcagactgttacttttaccacagga
gaggaagaaccttctggagctccaattgatgtcaatgttgaggctaaaggatcttcatct
ttgtttgttagttggaaggatcctccacgaagtgattggaatggactattgaaaggatat
tatgtaggttataaagtgcttgattcagctcaaccatattcttttaaaacattagagtat
agtcagagtgcaattcatgagcatatgatcactaatttaagaaaagatacagaatataaa
atagtagttaaagctttcaatgcagcaggtagtggtccagtttctcaggatgtgctagtg
aagacattgggaggagatcttccattgcctcctcatatatttcttgccagtactactgat
agttctattaaagttcagtggcatccacaagatacaagaactcctcttacagggcatgtt
attcactatcgaaagaaatttgaaagatggcagcaaattccagtattaactccttccgaa
aatgtgtttactattaatggcttagaaagtggtgctgaatatcaattatatgtcacctca
gctaatgaatttggagaaggagatcctagtgaattattgaatgttaaaacaactggtcat
agcaatgacaatttaattttgttaactggtggccaagatgctccgtattacttagattta
tcactgttggtacctatagcagcttctgtcgcagcaattattgttgtaactattgtagta
tgtatttgggtacaaaaagcaagaggaagaagaaatttagaaagagcccttagagaagag
aaacattataattatggccctgcttctcaacggtatgttgacatagaaaaatcaagacaa
tatccttatccagattctgatttatcttccaattatccaacaccatatgctacagtacca
atgagagatgatgtgtcagaaagtggcaatgatcctcatcaagaaatgaaatcatttctt
ccacaaaatatgaaagacagacctcttcctgtaccaaagactagctcattgaagaagaaa
gatgaatctcatatttatgataatggtgacatgcctataatcagaccattctctcttcct
cgtgatctcaaaattggagataaagtcagtattctctgttcagttagttccgggcaacaa
ccgctaacgtttcattggataaaagatggagaagaaatgtttgaaactaagaatataaaa
attcatagtcattccgatgtgtcagtaattactatacattctattaatgaaaatagtgta
ggaaactacacttgctttgtaagtaacaattttggaactacttttcacacagctgtatta
gaagtgccagtatctccatcttggaaaatcgaaccaaattctctcgatgtcgtggttgga
caaaatgccagtttacattgtgaagcaaatggatttcctgttccaactatttcatggatc
aaacaagaaaattcttttggtgaaaaagagaatttagtaatggaccataaattcatcatg
aatagtactttgcttttaattcatgtaaagaaagaagacggaggaatttatgaatgttca
gcaaaaaatggcataggaataggtttgaagaaagcagttagtttaataattaaagattat
gtttgcacagtgtctcccaaaattcgcccgtttgcttttcctcaagatttaaaaatgggt
gaccgtgtaagtgttatatgctctgccagttctggtacaagaccattaacatttcaatgg
aagaaagatacggacactctagtcgagggtaaaaatacagaaattcattttcatactgat
ctttcagttttagccattgattcaataacagatcagaacaatgggaattacacttgcata
gtttcaaatttagcaggaacaacaagttatagtacaatattaaccgtatctgctccacct
gaatggaaacaagaaccacacgatactgagagcgttattggttctaatataacaattcga
tgtcaagcctatggcttcccattgcctaccatacaatggcaaagaagagaaaatccgttt
catcactcggataaaagggtaggatcgctgaaagaaaattatctgattacttcagatgga
actttaataattacaaatattcaaaaagaagatgaaggcattttagagtgtgttgctaaa
aacggaattggaaaggaattaaaaaagtctgttacactatcagttaaggcaattaatcct
ataaacagtaatagctctggaaattattcttgtgttgtatcgaataaattcggtacgaca
tcttacacagccattttagaagtaccagtaccgcctatctggaaacaggaacctcaaaat
atagaaagtattatcggtaacaatgtaaccatagcttgtcaagcaaatggttatcctcct
cctactgtaacatggacaaataaagttactgtcgaaggaaatttgattataacaaatata
cagaaagaacaagaaggaataatggaatgttctgcgagaaacggaattggagaactgaag
aaaattatcactattaccgttaaagaacctccaggaattaatccttttaattttccatct
aatttaaaaattggtggaagagttagtgttatatgtgcagtgatttcaggctcaaagcca
ttcaaaatttggtgggagaaggaaagtagaactattaaagaagacaaacatattactatt
catattcacgctgttgaatcagttttaagaatcgatcccataactgtcgaaagctcagga
aactattcatgcatagttagtaacgaatttggcacaactaggcataatgcagtcttagaa
attccaatgtctcctacatggattttagaaccaaaaaatacagatattgtggtaggtaac
aatataaccattcaatgccaagcgcatggttttcccataccaaatttatcttggagtcgg
aaagatattcctaaaattgctccattttcctttcctcccaatttaaaaattggagatata
ggaagcgtaacatgttctgtaacctctggcagccgaccattaaaatttcaatggaaaaaa
gatcatatcgatattaacgaaaatacaaacgtagcagtgcttacacattcagatttatca
gcagtatcaataaaatctattaaagaagaaaatatcggaaactatacttgcacagtttca
aataaatatggttcaaatagctacatgacaagattagaagttccaataccgccaacgtgg
aaaattgaaccaaaagatatcgaaattgttaaagatgataatgtaactataaaatgtgaa
gcaaatggctttccaacaccaaaaatggaatggactaaaaaatatggtgacatgcctata
atcagaccattctctcttcctcgtgatctcaaaattggagataaagtcagtattctctgt
tcagttagttccgggcaacaaccgctaacgtttcattggataaaagatggagaagaaatg
tttgaaactaagaatataaaaattcatagtcattccgatgtgtcagtaattactatacat
tctattaatgaaaatagtgtaggaaactacacttgctttgtaagtaacaattttggaact
acttttcacacagctgtattagaagtgccagtatctccatcttggaaaatcgaaccaaat
tctctcgatgtcgtggttggacaaaatgccagtttacattgtgaagcaaatggatttcct
gttccaactatttcatggatcaaacaagaaaattcttttggtgaaaaagagaatttagta
atggaccataaattcatcatgaatagtactttgcttttaattcatgtaaagaaagaagac
ggaggaatttatgaatgttcagcaaaaaatggcataggaataggtttgaagaaagcagtt
agtttaataattaaagtttctcccaaaattcgtccgttttcttttcctcaagacttaaaa
atgggtgaccgcgtaagtgttacttgttctgtcagttctggtacaagaccattaacattt
cagtggaagaaagatgcagatatcttacttgatggtaaaaacatagaaattcttttccac
actgatctcacggttttagccattgattcaataactgatcaaaacaacggaaattacact
tgtatagtttcaaatttagtaggaacaacaagttatagtgcaatattaatcgtatcagca
ccacctgaatggaaacaagaaccacacgatactgagagcgttattggtaataatataacg
attcgatgccaagcctatggtttcccattacctactatacaatggcgaaaaaaggaaact
ttgtttcatcatttggataaaagtatggagactttgaaagaaaattatcagattacctta
gatggaactttaataattacaaatattcaaaaagaagatgaaggaattttagagtgcatt
gcaaaaaacggaattggaaaggaattaaaaaaatctgttacactatcagttaaggtaccg
cctatctggaaacaggaacctcaaaatatagaaagtattatcgggaacaatgtaaccgta
gcttgtcaagcatatggttatcctcctcctactgtaacatggacaaataaagttactgtc
gaaggaaatttgattataacaaatatacagaaagaacaagaaggaataatggaatgttct
gcgagaaacggaattggagaactgaagaaaattatcactattaccgttaaagaacctcca
ggaattaatccttttaattttccatctaatttaaaaattggtggaagagttagtgttata
tgtgcagtgatttcaggctcaaagccattcaaaatttggtgggagaaggaaagtagaact
attaaagaagacaaacatattactattcatattcacgctgttgaatcagttttaagaatc
gatcccataactgtcgaaagctcaggaaactattcatgcatagttagtaacgaatttggc
acaactaggcataatgcagtcttagaaattccaatgtctcctacatggattttagaacca
aaaaatacagatattgtggtaggtaacaatataaccattcaatgccaagcgcatggtttt
cccataccaaatttatcttggagtcggaaagaagatgaaggtatttacgaatgtacagca
ataaatattcttggtactactcttcaaaagacaataactgttattgtaaaagatttacct
gttattgcaccattcaattttccgcagactataaaagttggtaacagaataagtgcaatg
tgtactgctacatctggggatcaaccctttgtttttaactggaaaaaggatcaggaagat
atatcagaaaattctgtaattaaaatcataactgctaatcatatatcagtaatatctatc
gattctgtaagttcagaaaatgcgggaaattatacatgtatcgtatcaaatgcagtcggc
actgcaagtcatacagcgacattgattgttccaatatctccaagttgggaaaaagaacct
aaaaatgtagaagttgttgttgataccaatgtgaccatcgaatgtcaagcgtctggatac
cctaaaccttctataacttggaatattaaagaaaattcttttggtgaaaaagagaattta
gtaatggaccataaattcatcatgaatagtactttgcttttaattcatgtaaagaaagaa
gacggaggaatttatgaatgtttagccaaaaataatttaggagaaatcagaaaggcaatt
actgttactgttaaagaattaccagtgattaaaccatttacgtttcctgacaatttgaaa
acaggagatagtttaagtgtgtcatgttctgttatttctggtgataaacctttaacgttt
atgtggatgaaagaaaacaaagagattaaagatggttcaaacgctaaaattcatactcat
actagcctttcaatattagctatagatcctttagatgaacaaaacagaggcaactatact
tgtattgtctctaatgcctttggttcaacttcacatacagcaaacttacagattccagtt
ccgccttcatggatagaagaaccgaaaaattctgaagcagtcgcaaatggtaatataaca
atactttgtcaagcttctggatacccaaagccaactattacttgggtacgaaaagaaggc
cctttcgattcttctgtcagtatggataataaagaaattaaggacaatgaaaaactgaca
tttgttaagatctcaaagaatgacgaaggtttatatgaatgctccgcatataacggtatt
ggaacttctctgaaaaagaccatcacgttaagtgttaaagaatcgccaaagattcagcca
tttcattttccatcagaagtaaaaatgggaagtaaaattagtattggctgttttgcactt
ggaaaaaaaccattaacatttaattggttaaaaaataatcaaaatgtaaaagacatctct
ggaattcatttaaaaacagacgaagagttttctgttttaacaatagagcctgttgattta
aaaagtattggcaattatacatgcttagtacagaatagtataggagaagataaatttaca
gctcagcttagagttaaaaaaaacgattattccacaaacaacgttcaaaaatcggaaaat
ggtacattttatattacaaatgtcgatatcaaacacagtggaaattacgtctgtgaagct
gataatgggatacctccaagtttaagaaagataattacggttatagtgcatgttatgttt
ttagatactcccgttattcaaccctttagttttcctgataatataattgctggtaaatct
atcagtatattttgtacagttacagatggaattaaaccaataacttttagttggttaaaa
aataatgttgttctaacaagtgatgaagacatcaaaattaataatcatgatttgtattct
gcattgataattgatcacgttgatgttagacataaaggaaattacacttgtaaagtaaaa
aataaaattggctcagacagtcacactgctttctttgatattaaagttcctcctagatgg
atcacagaaccaatggatcattcgatcatttttggttctaatcattatctggattgtaag
gtattcggatttccgcctcctcaagtaaaatggttaaagttagacgatagttcagaaaat
acaccaattttagctgcagaaagtgatagatggaccgtgcttaaaaatggcacaatcatt
attacaaatgtgaaaaaggaagacagtggaacatatatgtgtcaagctgataataaattc
ggcaatacacttaaaaaaattataaaaatagacgtatttgttccagcaagatttgaagag
aaatatagcacagtaaccagtaagaaaggagatagcgccagactgaggtgcgatgctatc
ggagatcaaccgttatcaataacgtggaaaaaaggccccttacagttatcgaaaagtaga
aatgctagatatgaagtattcgagactcttacatcggagggtcttcaatctgaattagtt
attcgagaaacaaaacgagatgatggctctatatatatatgtattgccgaaaacacatat
ggatctgatgaaagaaaagtcaaattgtctatattagaggttcctggacgccctcaaaat
gttaaaattgctgaaaggtggagtcgaagtgccacagttgtctggtccgtgccttataca
ggaaatagccctattacaaagtatatagtgcagtattggcgagaaaaaggtgcacctcat
cgtcttcatgaacatcctatatcaagtttgcaaacctctactatgatagataaattacat
ccaggcacttcttatgttgtgaatgtagtagctgaaaattctgtcggaagaggtgaagca
tcaaaaccagtacgttttcatactggagaagaagaacccagccttccccccgtcgatgtt
agtatcgaacaaaagggccctactaccattaaagtaacttggaaacctccacctttggac
agttggaatggtcagttaaagggatattatataggttataaaattagagcagcgcctata
gcacagtcatataactttaaatttgttgagtatggaggagaaagaactcaagaatatctt
ctcaccaaactgatgaaaggcactgaatactgtattgtcgtacaagcttataattctgca
ggtagtggaccaccttgtcatgaaatgatagaaagaacaactgatgcagatgttccacat
tctccctttctctctctaatgtcagtcactgtgagttctatcagtgttaattggctagca
aaacattctaaaacaccattaacaggattcatattgcattatagaagaggatttaattct
tggaaagagacatctttaataccagctaatgagaaacaatatacactgagcaatttagat
agtggaacgttttatgaattatatttaactgctgcaaatcaagcaggaaaaagtgatcct
agtgatactctcagagttagaacagattttgttgaaggctataaattatcttctgtcatc
gataagactgtatggaatcctccatatttccagatatcagtacttattccaatagcggct
tgtctaacttccatatttgtagcaattatagtagcgtgtgtctgcgttagaaagctcaaa
aacgaaagaagaaaacgaggcttaatggaagataaacaatctaactatggaggtacgata
caaagatacgttgatgtagaaaaaaatcgtcctcttgtaaataacgaatgttccatgtct
tcactttatccagcaccttatgccactattcccatgagagatgatccagaaggagatttt
gccaaaagtggtatggatcatgaaatgaaaacatttgtacagcaaaatcacatcgaacga
ccaataccacctcctagacctagttctctaaagaagaaaattgaattacgggcgactaaa
ggaggaataagtagagctggtgttcatgtttggtactattctccgaaaattcagcctttc
aatttccctcgtcatattcgagttgggcaaaaagctacagttacgtgtctagttttattt
tctgacgaatctctatcgtttacatggacaaaagatggaaaaactgtacctgataattct
gaaatacgcataaaacacgaaaaagattattccgttattattgtcgatcctgttaaaata
cagagtcaaggaaactatacctgtaaagtgaatggcaatttcggaagtgatgcctacact
acagaacttttcgttgaagatgcacccacatggagagaagaaccacaagaccaaatcgca
attttaggtaacgaattagaattacgttgtaaagctaatggctctcctaaacctcaaata
ttatggaaaaaacttaaaatgaaaataattcctataacggattatgaatatgcttttaat
atcgatattcaagtgctcttgtttaataatacaaacatctttagtcctcgttacagcaat
gttcgatataatttttatttatttgtagatcctcttaaaatcgagccttttaattttcga
agagttccaataggtgaaacaacaactgctttatgtgcagtaacatcaaaaactaaacat
gtctcatttacttggctaaaaaatggtgaaaccattaataagtcggatgaaataaaaata
aaacacgatttagattattctgttataaaaattgattcagtgaagctagatagtagaggt
aattatacttgtgtggtgagaagtggaacgtatgtaaattcttttacagcgcaacttgaa
gttgaagcttctccatcatggttagaggaaccttttgatataactaacatgttaggtgaa
ccaatgcacttacattgcagagcttctggttcacccgaacctaaaattatctggagacga
tttgaagacaatagcaatagcaagcttttatcttcaaacaaaaatggctctgttctgatc
aaagagacaaatgaaaaagaccaaggaatataccagtgcgaagccgacaatggaattatg
ccttcaatcaaaaaaaatatcagtgttaaaatatatgataatcagggaaattacacgtgt
gtggtaactaataattttgggagtgacagctataccgctcagcttcttgtcgaagcccct
cctcaatgggctgaagaacctaaagatgcaattatgatagcaggggagactgttagtatt
cattgccaagctacaggatcgccaaaacccttggtaacctggaaaaagctcgaaggaaaa
actccaaaaaatattttaaacggaaaattgacgccaatttcagtagacaatggtacatta
atattcaaaaatgcttctgccgagctatctggtttatatgaatgtgaagccagcaacagt
attggacaggctataaaaaagacaatagagctaactgttaaggttcctgccagatttgaa
gaaaaatttacagttattactgccagaaaaggagaaagttctaaaataagatgtgaggcc
ataggtgaccaaccagtttccattgtatggtcaaaagaagatattaagttaaacaaagcg
ggaggaacgagatacgaaattttcgagacacttttgcctaaaggcatggtgtcagagtta
attattcgctcgtcagaccgcgaagacggagcgttgtacacctgtgttactgagaatcaa
tatggtcatgaccaaagaaagatcagattattagttatggaagtgccagctcctccatta
gaccttaaagtacgcgaagtttggagtagaagttgtagtatttcttggtcttctccttac
agtggcaacagtcccattacaaaatatatcattcagtattggcgggatcaaggttccggt
aatcgtctttacgaaaaagaagttccaagttctcagtctaatgcccttattaaagatctt
catcccggaacatcctacatgttaaaagtcgtagcagaaaatacagttggaagaggcgat
ccctctgcatcagttgtatttcacactggagaggaagaaccaagttctccaccagttgat
atttcagtagaaagcggtgggtcgtctaccataaaagttacttggaagccgccacctaga
gacaactggaacggtaatttgaaaggatactacattggatataaaagcagagattcaaca
cagccatattcttataaaactgtggaatatgttccgaatagaacacaggaatattttctt
acaaatctacttaaagctactgattacagtgttatagttaaagcctttaattccgcagga
ggaggtcctgcatctcacgaagtaattgtcaaaaccttagatggagatttgccaagtcca
ccgtccgtttatgttttatctacctctccgacatcaatcacacttagaaggaattctaaa
agatctgacactgcagttacaggttacacaatttattataaagaagaagaagaaggagaa
tggcaggaggttccaattacttcaattgatgataatacctacgttttgaatgaccttaac
attggcaaaacctaccaactttacatcaccgcttccaatcaatacggaagaggcgatccc
agtgagatcattgctgccagaacagtagatagagctctcctagctgtggttggcggcgct
catccaccttatttagatttagcagttctagtaccagtagccgtgtctttacttactata
gttatagtaattactgttgcttgtatctgtgttagaaaaatccgaaaaagacaacatata
gaaagagctctagcagcggagaaacacttatcgttacccggcaccatgcaacgttacgtc
gacgtggacaaagccagaccactggtacaagtggacccttccatccaagagaattatcca
tcaccttatgccacaatgcctatgatggacgaatcggaaatcaattatagtaaagaatgt
ctcaatcaagaattaaaaacctttttccctcaggacagaccagtctatcctaaaccgagt
tcattaaaacgaagggacgatcacatatatgacatggtggaaatacagcctttttcattt
ccaaaaaacatagacgaaggtcaacgagtacaaacaacgtgcgctattcgcaaaggaaaa
ggtgatttaagtttctcttggaagaaagatggtcagcctatagaaagtaatacaatgtgg
acaatatattctcacgaaatggcatccatgtttatgataaataacgcttcggtagaaagt
acgggaaactacacttgcatggtaaggagtgcttcttcagaagatgcctacactgccgca
ttgattgttacaggaccgcctaaatggttaaaagaaccagcagacttggccgtagccgcg
ggcgataatgccactctggagtgtcaagcgtatggaaatcctgatacatctttcacgtgg
aagaggagccgagacgataagaaaacatggcacgacatcgaagacggacacatgaagata
gaggcaaaaggcactttaacattttacaacatacgcgtaacggatgcgggatattataat
tgcgaagtaacgaacggattaggtaccttacagaaaacaattgttttaaaagtcaaagaa
ataccaaaaatccaaccgtttttctttcccaaaaacttgactgctggtaaaacagtcaaa
gtgatatgtaatccatcagaaggaagcgttccttttactttcgaatggttgaaagatggc
acacaagtcgtcccttctacccatgtggctgttaagacccacgaggactattctttatta
aacatcgattctgttagttgggaagatgctggaaattacagttgtgtgcttaataattct
gctggtagcgatacatttactgcaacactatccgtttttgcatcaccggtttggctaaaa
gaaccgcaagatacgtcagtagctaatgaaggaatggtagttatagattgcatagctgcg
ggttatccgcaaccgataattaaatggagaagattacaaggtagggtatctacagtacta
aaatccgaaggcagatattttcttgcttctaatgggtcattgattattcgtccaagtcag
ctgaatgattctggttcatacgagtgcagagcttccaatgggatggctaacgatttaata
agaacaattagtttaactgtacacgttgcagctaggttcgagcagaaattcgccgtccat
acagtgaagcttgcagaaacggctaaattacggtgtgatgctgtaggcgacaatccgaca
acaattacgtggacttacaaccatcagtctattacacaacatcaaagctcaagatacgaa
atattcgaaagtattaccgataaaggtaccacgtcggaactccatatacatgatgcagat
agaggagacaatggacaatatgtatgtgttgcgaagaattcttatggcaaagacgaaaga
actgtaaaattagtcgtactcgaagttccaggatctccttcggatgtcagaaccgaacag
acatggagtcagagtgccagcgttagatggacctctccttataatggcaacagtgctatt
actcaatttattatacaatactggaaggattccggaacttcccatcgtttagaagaagaa
actgtatccccaacacaaaacacaatgactttacacaacttgcatccaggtactgcctat
attgttcgtgttttagctacaaatgagattggaagaggaagtccttcggagtctgtccaa
tttattaccaaggaagcagcaccgtctgctccccccactgatgtttctgtagatgcaaag
ggtgctggcgctctgacaatcaaatggaaagctcctccaagggaccaatggaacgggtta
ttaaaaggttattacgtgggatacaaaatccaaggcacgagtgattcgtatacttataaa
acggtcgattttaataagcatctggaggaggaatacagattatctggtttaaaaaaagcc
acagagtattcagtagttgtgcaggtttttaataacgccggtagtagtcctccctctcac
gaaatcatagtgaaaacttcagaaaaagatcctccattacctccatatctatggttagag
tcccgatctcgctcaagtatatctttaaaatgggaccacaaaagtaaagaagaacaacag
gaaatacattatattctgttctacagagaagaaagtggaacgtggacggaattagccgtg
cctcgcgattctcacaaccaatattcgttaacaaatttaagggaaggtacaaggtaccag
ttatatttgaaagcctatagcgaagcgggacagagcgattctagcgagatgctatcagtc
aaaactgaaggtggagctctgtctgattcttcttcttatccaatacacgaacgagaaaac
gacactcctgtgtatctcagggaaacagttattgctcctataggagtatctgtggccata
gtcctattggttgtctttggtgcttgtctgtacgttagacgagaagaaaaaaaatacaga
gcagccttagcaagcgtgacagataaacgctatccttatggaggaaaccacacccttcct
catatgtccagtcagcgttacgtagatgtggataagagtagacctttaatccggtctccc
ctaccgccaccgccaccttcagcttccgatacttatcctgcctatccagccccctacgct
actttaccgttacgaggcggaacactggatcgtcgcaggttctccgaagatcaacaaagg
gccacctttctagctcagcataccctagatagaaaacggtctacagggcatgtaatacaa
gaaacggccgaagtgcatcattacgatatggctgcatag

DBGET integrated database retrieval system