KEGG   Centruroides sculpturatus (bark scorpion): 111626285Help
Entry
111626285         CDS       T06064                                 

Definition
(RefSeq) histidine decarboxylase-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00340  Histidine metabolism
cscu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    111626285
Enzymes [BR:cscu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     111626285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 111626285
NCBI-ProteinID: XP_023225375
Position
Unknown
AA seq 629 aa AA seqDB search
MNLEDYRKWGKILIDYTADYLENIRERRIFPDVKPGYMRPLLPESAPIEGEKWEDIFNDI
ERVIMPGVTHWQSPHMHAYFPAINCPGSLLGDILSNAIGCLGFTWASSPACTELEIIVMD
WLGKMIGLPEAFLHDHSNGLGGGVIQTSASEATFVALLAARTEVIQRVKKDYPDLDEAEI
NGRLVAYCSDQAHSSVEKAGLIGLVKMHYIESDENLSLRGEKLKETVERDKQKSLIPFFL
CATLGTTGACSFDNLSELGPICQKENIWIHVDAAYAGTAFICPEFRKWMKGIEYVQSFAF
NPSKWMMVHFDCTAMWVKNSGALHRTFNVNPLYLHHENTGLAIDFMHWQIPLSRRFRSLK
LWFVIRSFGITGLQEHIRYTIKLAIEFEKLVQEDKRFEIPAKRHLGLIVFRLKGENELTE
KLLKRLNSDGKIHCVPASLKGIYVIRFSVSSPRITSEDIRLDWKIIQITATEILQMYSNK
ITVNKPSIKEVKKRNPEFGTSLLLANSPMIPKIMNGSYVAIFDNTEAIDQFIQRFGNAFG
NLAKDSPSLRRRIRGLSISNKQYSLDSRMDLMNSIVATAMNLSTASQRTSTPKEKNCLKE
SISEEDDSSNLVVCSTKCQMCGQVTSKEA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggaagattacagaaaatggggaaaaatcttaatcgattacacggcagattat
ctggagaatatacgcgaaagacgcatttttcccgatgttaaaccgggatatatgaggcct
ttattaccagaaagtgctccaatcgaaggcgaaaaatgggaagatattttcaacgatatc
gaacgagtgatcatgccaggggttacccactggcaaagtcctcatatgcacgcttatttt
cctgctataaattgtcccggttcgttacttggtgatatattatctaatgcgattggatgc
ttaggttttacatgggcatccagcccggcgtgtaccgaattagaaattattgtaatggat
tggttagggaaaatgataggattacctgaagcgtttcttcacgatcattccaatggtttg
ggtggaggagtcattcagacttcggcgagcgaagcaacatttgtagctttgcttgcggct
cgaacggaagtaattcaaagggttaaaaaagattatccggatttggacgaagcagaaatc
aatggtagactcgtagcatattgttccgatcaggctcattcttcggtcgaaaaggcagga
ttaatcggattggttaaaatgcattacatcgaaagtgatgaaaatttgagtcttcgagga
gaaaaattaaaagaaaccgtagagagagataaacagaaaagcctcattccattttttctt
tgtgctacattgggcacgactggtgcttgctcctttgataatttaagtgaattaggacca
atctgtcagaaagaaaatatttggatccacgtagatgctgcttatgcaggaactgcattt
atttgtcccgaattcagaaaatggatgaagggcattgaatacgttcaatcgtttgcattt
aatccttcaaaatggatgatggttcattttgattgtactgcaatgtgggtgaagaatagc
ggtgccctccaccgaacatttaatgtgaatcctctctatcttcatcacgaaaacacaggt
ctagctattgattttatgcactggcaaattcctctcagtaggaggtttcgatcgctaaaa
ttatggtttgttattcgaagttttggaattacgggacttcaagaacatattcgttacaca
ataaagttagcaattgaatttgaaaaattggttcaggaagataaaagatttgaaattcct
gctaaaaggcatttaggattaattgtatttagattgaagggcgaaaatgaactaacagag
aaactattaaagcgtttaaattctgatggaaaaatacattgcgttccagcatcgctaaaa
ggaatttacgtaattagattttcagtttcctcacctcgaattacatccgaagatattcgc
ctcgattggaaaatcatccaaatcacagcaactgagattctacaaatgtattcgaataag
attacagtaaataaaccttctatcaaagaagttaagaaacgaaatcccgaattcggaaca
agtttactcttagctaatagtccaatgataccaaagatcatgaatggcagttacgtagct
atttttgataatacagaagctatagatcaatttatccaacgttttggcaatgcatttgga
aacttggcgaaggacagtccctctcttcgtcgacgtattcgaggtttaagtataagcaat
aagcaatacagtctggattcgagaatggatttgatgaacagcattgttgctacagcaatg
aatttatcaacagcttctcaacgtacttcaactccgaaagaaaagaattgtttaaaagaa
tctatttccgaagaagatgattcttctaatttagttgtttgttccacaaaatgccagatg
tgtggtcaagttacatcaaaagaagcttaa

DBGET integrated database retrieval system