KEGG   Centruroides sculpturatus (bark scorpion): 111626699Help
Entry
111626699         CDS       T06064                                 

Definition
(RefSeq) erlin-2-like
  KO
K23341  erlin
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cscu04121]
    111626699
Ubiquitin system [BR:cscu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    111626699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 111626699
NCBI-ProteinID: XP_023225948
Position
Unknown
AA seq 254 aa AA seqDB search
MGLPIGHVAVYYRGGALLRQTSSPGFHMMIPFITTFRSIQVTLQTDEVKNVPCGTSGGVM
IYFDRIEVVNILNPPSVFDIVKNYTADYDKTLIFNKVHHELNQFCSIHNLQEVYIDLFDQ
IDENLKLALQKDLNLMAPGLFIQAVRVTKPKIPETIRKNYEAMEGEKTKLLIAAQKQKVV
EKDAETERRKAEIDAEKVASVAKIQFEQKIMEKESLKKIAFIEDEMQLARRKMEADAEYY
TKQKLSESNKVFYI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggactacccataggtcatgtagcagtatattacagaggaggagcattattaaggcag
acgagcagtcctggtttccatatgatgattccatttattacaacatttagatcaatacaa
gttacactacaaacagatgaagtaaagaatgttccatgtggtacaagtggtggtgtaatg
atttattttgatagaattgaagttgtaaatattttaaatcctcctagtgtatttgatatt
gtgaaaaattatactgctgactatgacaaaacattaatattcaataaagttcatcatgaa
ttgaatcaattttgcagcattcataatcttcaagaagtatatattgatttatttgatcaa
attgatgaaaatttaaagcttgctcttcagaaagatttaaatcttatggcacctggatta
tttattcaagctgtaagagtaacaaaaccaaaaattccagagacaataagaaaaaattat
gaagctatggaaggtgaaaaaactaaacttctaatagctgcacagaagcagaaagttgtt
gaaaaagatgctgaaacagaaagaaggaaagcagaaatagatgctgagaaagtagcttct
gtagcaaaaatccagtttgaacaaaaaatcatggaaaaggaatctttaaaaaaaattgca
tttatagaagatgaaatgcaattggcaagaagaaaaatggaagctgatgcggaatattat
actaagcaaaagctctcagaatcaaataaggtattttatatttaa

DBGET integrated database retrieval system