KEGG   Centruroides sculpturatus (bark scorpion): 111633653Help
Entry
111633653         CDS       T06064                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit-like
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cscu04040]
    111633653
Ion channels [BR:cscu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111633653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin Claudin_3 L_HMGIC_fpl DsbD_2 SUR7 CD20 S1FA DuoxA
Motif
Other DBs
NCBI-GeneID: 111633653
NCBI-ProteinID: XP_023234028
Position
Unknown
AA seq 327 aa AA seqDB search
MPKISIRCLRILSLLSAIISLVAQGIALCSNCWLHSEELMANPKYNGTGDREYLSKFTVS
GLWKLCFNDPVNASEVRCFNIDYFPKEEYSPDPNDSTMAIPYAVKRAAIFILVSTFILII
GEILCFFGHLLRRRWVLTFASGIAFILSGLLILMGMVIYISTFKAEVGNKLRPKSSFQGP
MFKYSYGFSFLLAVVGLMMCELAGTFAIFLYIQKYEEEIKKKAERQKYADFLPQGEDHVP
CRRHRGRKNSRAREMSREASPCPSTSRGRRPTNTGIALSESMRDLAYCNFPPFSRDTTCN
TVSTTADINREYSRDFSFDTLRRTTPV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagatctcgatcagatgcttaaggattctgtcgttactgtcagctatcatttca
ctcgtagctcagggcatcgccctatgttctaactgctggttgcatagtgaagaattaatg
gccaatcctaaatacaacggaactggtgacagagaatatttgtccaaatttaccgtatcg
ggactttggaaactctgtttcaacgatcctgttaatgcatccgaagttcgttgtttcaac
atagactattttccaaaagaggaatacagtccagatcctaatgattcaaccatggcaata
ccgtacgcagtgaaaagagcagcgatattcatcctggtcagcacttttatcttgataata
ggagaaatattgtgtttttttggtcatctcttgagaagaagatgggtgcttacatttgcc
tctggtatcgcctttatcctctccggtttattgattttaatgggaatggtcatttatata
tcgacatttaaagcagaagttgggaataagttaaggcctaagtcttcctttcaaggcccc
atgtttaaatatagttatggcttctcatttcttttagcagtcgttggtctaatgatgtgc
gaattagcaggaacgttcgccatttttctttatatacaaaaatacgaagaagaaataaag
aaaaaggccgaacgccaaaaatacgcagattttcttcctcaaggggaagatcacgtgcct
tgtcgacgtcatcgtggtagaaaaaacagtagagcacgagaaatgtcacgcgaggcatca
ccgtgtccatcaacaagtcgtggacgtcgtcctacaaatacagggatcgcgttgtcagaa
tctatgcgtgatttagcatattgtaatttcccccctttctctagggacaccacgtgcaat
actgtttctactacagcagacataaacagggaatattcacgagatttttctttcgataca
ctgaggcgcaccactccagtgtga

DBGET integrated database retrieval system