KEGG   Centruroides sculpturatus (bark scorpion): 111638738Help
Entry
111638738         CDS       T06064                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cscu01001]
    111638738
   01009 Protein phosphatases and associated proteins [BR:cscu01009]
    111638738
Enzymes [BR:cscu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111638738
Protein kinases [BR:cscu01001]
 Serine/threonine kinases: Other
  Wnk family
   111638738
Protein phosphatases and associated proteins [BR:cscu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111638738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 111638738
NCBI-ProteinID: XP_023240264
Position
Unknown
AA seq 1409 aa AA seqDB search
FRYLRRFKKINLKVLKSWCKQILKGLNFLHSRCPPIIHRDLKCDNIFITGTTGSVKIGDL
GLATLKNRSFAKSVIGTPEFMAPEMYEERYDESVDVYAFGMCMLEMATSEYPYSECSGPA
QIYKKVISGVPPLSFNKVEIPEMKDIISLCIQLEKENRPRVKELLQLEFFQDEVGIKVEF
VNREDSIASKAMKMELRLRVLDPKKRKDKYKENEAIQFDFDIENDNAEEVAGAMAMTGIL
MEDDVRLVALLIRIQIASLLRERQQTTQEYESKQTSTDEKLQNNDQTSQLQPNSQATGIV
PQKSAYTSAAININQTNESLDPVTGNHLNLENTPPSHFQSSQASVAVVYTSVGQVIGSSQ
QNVFTSINQPNLTNFSQGGQQILSTSQIALQSSHPSTVGLHLGYQQQLQSGQEPSQSLSL
ILPQSSTICSVPAQEQGLSASQSVLHPPVNQVLGFSQSTLPYSTSTSFQLPHQVVTEQPT
AVSLQSSIPQQIDSIDKIAEASCSQYTIQSPLQIDNKSELPITPILTIPTSFQGAGLIEN
TITQEQFGSPQKSWIPQAAVIQQQSNSLSSSLPFQNLPSTTLQFTPYQQVGSSNNLTQHF
LATTPISSNPPAKFIPFSSISSRMDNASLSMECQENFQNSCNSNPNCPITNQSNSHYIIM
TVPSNGNQQPIQKRACSIGCPPFQYTSNSSYSNSPVQLTNNHVSNFVRSHSFSQAFTPVS
HVGRSYNHVQSPLALQNNRSFSNNIYLTHPEQSTCIQPNSRPSTPFPPIQVLVHDHVPSR
NSPVNLTPPPQLLSFPQPPQSPNVIRPVTRVASPLTLPIGSSPPSPLPTPPHTPDYSTSS
KENFTYSNIARAASPYPSSNGRIHISRSSTSTPCSPVYTCIQPSFHLQSKRDLCRSTSVI
AVPTHSQSSKYLLSQNSASTPSSPVSSSFLSSFPTQQSNVSQQEDQTDIKHYELSNYPNN
NLQVEYGFTPLQIPSSSANSFNSMSNNLVFIPLENISCSQELNAISKPAMTISSMCLSQQ
DKIGPMEHTPNSQIPQTWVPLTSLAMPTQFVPVSMAKTDNAQSMNEVDKPNPVYLSPQRS
LPSIKLQSSFLHPKNQDISNTQMQTTMQNLQVQQMDENKLDSNILSSDSACEQAESSEIS
KERAAKAERRKGKRRRTQDRMLRLTVLNVKDGTIVECELESTRGKTVTFKFDITDIVPAD
VANNLVVTNLMTEHHSEAFIELINDIVQQLKENPDKIPVIQYQDPSNTSSPVVQRRQTGH
EILDRKLSLESQDSTPSTPKYSEKETESSFANQTLAATAQVKPNSEPTPALVQNQPQVSE
PQHTVPMKIAQSPSPISQAQGMRSALRKKSARWKKFITFTHYVCCCELPHMLLPGFLSQV
SSFFICMASTAICGDRAHDKFFNHMHIEF
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
tttagatatcttcgtcgctttaagaaaattaatctcaaggtattaaaatcatggtgcaag
cagattttaaaaggcttaaactttttacattcacgctgtcctcctataattcatcgagac
ttgaaatgtgacaatatttttataacgggaacaacaggctcagtaaagattggtgattta
ggtttagctactttaaaaaataggtcatttgctaaaagtgttattggtacaccagaattt
atggcaccagaaatgtatgaagaacgatatgatgaatctgttgatgtatatgcatttgga
atgtgtatgttagaaatggctacatcagagtatccttattctgaatgtagtggaccagct
caaatatacaagaaagttattagtggtgttcctcctctaagttttaataaagttgaaatt
cctgaaatgaaggacataatcagtttgtgcatacaacttgaaaaagaaaacagacctcga
gtaaaagagttgcttcaacttgaattttttcaagatgaagttgggattaaagtggaattt
gttaatcgtgaagacagcattgcaagtaaagcaatgaaaatggaactgagactcagagta
ctcgatcctaaaaagagaaaagataaatataaagaaaatgaagcaatacaatttgatttt
gatattgaaaatgataatgcagaagaagttgcaggagccatggctatgaccggcattctt
atggaagacgatgtgcgtcttgttgcattattgattcgtatacaaatagcttctttgctg
agagagagacaacaaacaactcaagaatatgaaagtaagcaaacttctacagatgaaaag
ctacaaaacaatgatcaaacttcacaattgcaaccaaattcacaagcaacaggaattgtt
ccacaaaagtcagcttacacatctgctgccattaatataaatcaaacaaatgaaagccta
gatcctgtgacaggaaatcatttgaatttagaaaatacaccaccttcacattttcagtct
tctcaggcttccgtggctgttgtgtatacgtcagttggccaggtgattggatcaagtcaa
cagaatgtttttacatctataaatcagccaaatttgacaaatttttctcaaggtggtcaa
caaatactttccacctcccaaatagccttacaaagttctcatccttccacagttggtctc
catttgggatatcaacagcaacttcaaagtggacaggagccttctcagtcactctctctt
atcttacctcagtcatctacaatttgctctgttcctgctcaagaacaaggactttccgct
tcccagtcagttctccatcctcctgtaaaccaagttttaggtttttctcaatccactctg
ccatatagtacttcaacttcttttcaacttcctcaccaagtagtgactgaacaacctaca
gcagtttctctacagtcttccattccacaacagatcgatagtatagataaaattgcagaa
gcatcttgctcacaatacacaatccagtctcctctgcagattgacaacaaaagtgaactc
cctattacaccaattttaactattcctactagttttcaaggtgctggcttaattgaaaat
accattacacaagaacagtttggttcaccacaaaagagctggatacctcaagctgcagtt
atacaacaacagtctaattccttatcatcttctcttccatttcaaaatttgccttctaca
actctacagtttactccatatcaacaggtaggctcttctaataatttaacacaacatttt
cttgcaacgactccaatttcatctaatccacctgcaaagtttattcccttttcaagcata
tcatcaagaatggataatgcttcgttatcaatggagtgtcaagaaaattttcaaaattcc
tgcaattcaaatcctaattgcccaattactaatcagtctaattctcattatattataatg
acagttccttctaatggaaatcagcaaccaattcaaaaaagagcttgctcaattggttgt
ccacccttccaatatacttcaaattcctcatattcaaattctcctgtacagttgaccaat
aatcatgtttcaaattttgttagatcacattcattttctcaagcatttacgccagtctca
catgttggtagatcatataatcatgttcaatcaccacttgcccttcaaaataataggtcg
ttttcaaacaatatttatttaacacatcctgaacagtctacatgcattcaaccaaatagt
agacctagtactccatttccacctattcaagtattggtacacgatcatgttcctagcaga
aattcaccagttaatctaacaccacccccacagcttttatcttttcctcaacctccccaa
agtccaaatgttattagaccagtaacccgagttgcttctccactaacattacctattgga
tcatctccaccttcccctcttccaactcctccccatacaccagattattcaacaagttca
aaagaaaattttacatattcaaatatagcccgagcagctagtccttatccttcttctaat
ggaagaattcacatttctagatcttctacatcaactccatgttctccagtctatacttgt
atacagccatcatttcatttacaatccaaaagagatctctgtagatccacttctgtaatt
gcagttcctactcattcacaatcttccaaatatttgttatctcaaaattctgcttcaact
ccatcttctccagtttcttcatctttcctttcatcttttcctacacaacaatcaaatgta
tctcaacaggaagaccaaacagacattaaacattatgagttatccaattacccaaataat
aatcttcaagtagagtatggatttactcctctacaaattccttcaagttctgccaatagt
tttaactctatgtcaaataatcttgtgtttattcctttggaaaatatttcttgttcacaa
gaattgaatgctataagcaaacctgctatgactatctcctcaatgtgccttagtcaacaa
gacaaaattggaccaatggagcacactcccaactcacaaattccccaaacgtgggttcct
ctgacgtctcttgctatgcctacacaatttgttcctgtttctatggctaaaactgacaat
gcccaaagtatgaacgaagttgataaaccgaatccagtttatttgagtcctcagaggtct
ttgccttccataaagctacaatcctcgtttcttcatccaaaaaatcaggatatttctaat
actcaaatgcagactactatgcagaatcttcaagtgcaacaaatggatgaaaataagcta
gacagtaatattttaagctcagattcagcttgtgaacaagcagaatcatcagaaatttct
aaagaaagggctgctaaagctgaaagaagaaaaggtaaacggagacgaacgcaagatcgg
atgttgagattaactgtactcaatgtaaaagatggaaccatagttgaatgtgaattagaa
tctaccagaggaaaaaccgttactttcaaatttgatataactgatattgttcctgcagat
gtagctaataatttggtggttactaatctaatgacagaacatcattcagaagcatttata
gaattaataaatgacattgtacagcagctgaaggagaatccagataaaatacccgttatt
caatatcaagatccttctaatacatcgagtccagtagtacaacgcagacaaactggacat
gaaattcttgacaggaaattaagtctcgagagtcaagatagcactccatcaacacctaaa
tattccgagaaagaaactgaaagttcatttgcaaatcaaacactggctgctacggcacaa
gttaaaccaaacagcgaaccaactccagctttggttcaaaatcaacctcaagttagtgag
cctcaacataccgttccaatgaagattgcccaatctccttcccctatatctcaagcccag
ggcatgcgaagtgccctgaggaagaaatcagctcgttggaaaaaatttataacttttact
cattatgtttgttgttgtgaacttccacacatgctgctacctggatttttatcacaggtt
agttcattttttatctgtatggcttccacagcaatttgtggtgatagagcacatgataaa
ttttttaatcatatgcatattgaattttaa

DBGET integrated database retrieval system