KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Clst_1649Help
Entry
Clst_1649         CDS       T02527                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
csd  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
csd00450  Selenocompound metabolism
csd00970  Aminoacyl-tRNA biosynthesis
csd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Clst_1649
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Clst_1649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csd01007]
    Clst_1649
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csd03016]
    Clst_1649
Enzymes [BR:csd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Clst_1649
Amino acid related enzymes [BR:csd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Clst_1649
Transfer RNA biogenesis [BR:csd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Clst_1649
 Prokaryotic type
   Other AARSs
    Clst_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Anticodon_1 DnaI_N
Motif
Other DBs
NCBI-ProteinID: AGI39703
UniProt: L7VKQ1
Position
complement(1860018..1862009)
Genome map
AA seq 663 aa AA seqDB search
MTVDSDRPKFPKRAVVTAGMPYGNKELHLGHIGGVFVHADTFARFLRDRIGKENVIFVSG
TDCYGSPILENYRQLVENGEFKGTIDEFVQQNHKLQKEILDKYYIDINLFAASSFGPAAE
NHRKFSEEFITRLYENGHLIKMTTSQFYDPEVGMFLNGRQVVGKCPIEGCKSERAYADEC
SLGHQYMPQDLIDPRSTLTGKRPEMRDVTNWYFRLDGFRDLLVQWVERLESDESARKFMI
KSIKEFLEPPVIYVKREFLDVVEKIKDKLPDFTLIDEGKSSAVMSFDKLEKREKASLILA
ENGVRFRTGKTLVPFRITGNVEWGVPAPCIEGLDGLTVWVWPESLWAPISFTMTYLEMNN
RDKNEWKEWWCSKDSQVYQFLGEDNVYFYGPAEMAMFMAQQGKNPTVDPPEGQLQLPKLI
VNNHILFMNQKASSSGSIKPPSARDLLEYYTPEQLRAHFLGLGLGIRSVSFQPKPFNPSA
SEKDSDPVLKEGNLLTNVFNRAVRSCFYTAQKYTDGKIPVRKISEEVIKESNETILEYER
LMARFEFHQVMNLMDTYIRNMNKYWSKMIREADTTNNEELRLQVLADTFHMVRTAAVLMH
PIAPKGTEMIREYLRVGEELWSWDRIFDPIYEFMENPEEHKLKFLEPRVDFFKKHPSQIS
QNE
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggattcagacagacctaagttccccaaaagggcggtagttacagccgggatg
ccgtatggcaataaagaactgcatttgggccatataggcggtgtttttgtccatgcagat
actttcgcgcgttttttgcgcgatcgtataggaaaagaaaatgtaatatttgtttccggc
accgactgttacggctctccgattctggaaaactaccggcagttggttgagaacggtgaa
tttaagggcacaatcgacgagtttgtacaacagaaccataaacttcagaaagagatactt
gacaaatattacattgatataaatctttttgcggcttcaagtttcgggccggccgcggaa
aatcaccgaaaattttcggaagagtttataaccaggctttatgagaacgggcacctgatc
aaaatgaccacgtcccagttctatgatccagaggttggcatgttccttaacggccgccag
gtggtgggaaaatgccctattgagggatgtaaatccgaaagagcctatgcggatgaatgc
tcgttggggcatcagtatatgccgcaggatcttattgatcccagaagtacccttaccgga
aaaaggcctgaaatgagggatgttacaaactggtacttcaggctcgacggtttccgcgac
cttttggttcagtgggttgaaaggcttgaaagtgacgaaagcgcaaggaagtttatgata
aagagtataaaagaattccttgaaccaccggttatttatgttaagagagaatttcttgac
gtggttgagaaaataaaggataagcttcctgactttacgttaattgacgagggcaagtcc
tctgctgtgatgtcttttgacaagctggaaaaacgggaaaaagcctctttgatacttgcc
gaaaacggagtgcgtttccgcacaggtaaaacccttgttcctttcagaattacaggaaat
gtggaatggggcgtacccgctccgtgcattgaaggccttgatggtcttaccgtttgggta
tggcctgaatcactgtgggcacccatatcctttacaatgacataccttgagatgaataac
agggacaagaatgaatggaaggaatggtggtgttcaaaggattcacaggtctatcagttc
cttggcgaggataatgtttatttctacggacctgccgaaatggcaatgttcatggctcag
caggggaaaaatcccaccgttgatccgcccgaaggtcagttgcagctgccgaaactgatt
gttaataaccatattctgttcatgaatcaaaaagcaagcagcagcggaagtataaaaccg
ccttctgcgcgggatttgctggaatattatacccctgagcagttaagggctcattttctg
ggtctgggccttggcatcagaagcgtgagtttccagccaaaaccctttaatccgtcagca
tccgaaaaagacagcgatccggtgctgaaagaaggcaatttactcaccaatgttttcaac
cgcgctgtcaggtcgtgtttctatacggcgcagaaatataccgacggtaaaattcctgta
aggaaaataagcgaagaagtaattaaagagtccaacgagaccatacttgaatatgaaagg
ttaatggccaggtttgagttccaccaggttatgaaccttatggatacgtatatccgcaac
atgaacaaatactggtcgaaaatgatcagggaagcagacacgaccaataatgaggaactg
cgtttgcaggtgcttgcagataccttccatatggtcaggacagctgccgttctgatgcat
ccgattgctccgaaaggaaccgagatgattagggaatatctcagggtaggagaagaactg
tggagttgggacaggatatttgatcccatttatgaatttatggaaaatcccgaagaacac
aaactgaaattccttgaaccacgggtggatttctttaagaaacacccaagtcagattagt
cagaatgagtaa

DBGET integrated database retrieval system