KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_2461Help
Entry
Clst_2461         CDS       T02527                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
csd00330  Arginine and proline metabolism
csd00332  Carbapenem biosynthesis
csd01100  Metabolic pathways
csd01130  Biosynthesis of antibiotics
csd01230  Biosynthesis of amino acids
Module
csd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:csd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Clst_2461
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Clst_2461
Enzymes [BR:csd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Clst_2461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AGI40476
Position
2765513..2766328
Genome map
AA seq 271 aa AA seqDB search
MEELRREYLKNVKRIVIKVGTSTLTHETGRINLLRMDRLAMTISELINEGYEVILVSSGA
IGVGMGKLSLKERPQVMGMKQALAAIGQCELMNIYSKMFASYNQIVAQILLTKNDVDDDI
KKRNIENTFEHLLEKHVLPIVNENDTVSTDEISSMDHFGDNDTLSAVVAKLVNADLLIIL
SDINGFYDSDPRENKNSKLIDTVTEIDDRVMRCAGGEGTKLGTGGMVTKLNAAKIVINAG
IHMVLANGCDPFIIFDILRGEKIGTFFVAKR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctcaggcgggaatacctgaaaaacgtaaaacgtattgtaattaaggtcggt
acctccaccctaacgcatgaaacggggcggattaacctcttaagaatggacaggctcgcg
atgacaatttcagagctgataaacgagggatatgaggtaatccttgtatcctcgggcgcg
atcggagtgggcatgggcaaactgagcctgaaggaacggcctcaggtaatgggtatgaaa
caggcccttgcagccataggccagtgcgaactgatgaatatttacagcaaaatgtttgct
tcatacaaccagatagttgcgcagattttgcttacaaaaaacgatgtggatgacgatata
aaaaaaaggaacattgaaaatacttttgaacacctgctggaaaaacacgtgcttccgatt
gtcaatgagaacgataccgtttcgaccgacgaaataagctcaatggatcacttcggggac
aacgatacgttgtccgccgtcgtggcgaaactggtaaacgccgacctgctgattattctt
tcggatataaacgggttttatgactcggatccgagggaaaacaaaaactcaaagctgata
gacaccgtaaccgaaatagatgaccgcgtaatgcggtgcgcgggcggcgaaggcactaaa
ttgggcaccgggggcatggtaacaaagctgaacgccgcgaaaatagtcataaacgcggga
atacatatggtgctggcaaacggctgcgatccgtttatcatttttgatatcctgcgcggc
gaaaaaatcggaacttttttcgtcgcaaaaagataa

DBGET integrated database retrieval system