KEGG   Caulobacter segnis: Cseg_0142Help
Entry
Cseg_0142         CDS       T01221                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cse  Caulobacter segnis
Pathway
cse00260  Glycine, serine and threonine metabolism
cse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
cse01130  Biosynthesis of antibiotics
cse01230  Biosynthesis of amino acids
Module
cse_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cseg_0142
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cseg_0142
Enzymes [BR:cse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cseg_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADG08668
UniProt: D5VDW8
Position
158153..158980
Genome map
AA seq 275 aa AA seqDB search
MTKDRIDRRFAALKAENRAGFVTYVMAGDPDAATTLSVLKGLPAAGADLIELGFPFSDPM
AEGPTIQRAAQRGLKSGMTLQGTLDLVAAFREGDQDTPIILMGYLNPVLHRGFESFADAA
AKAGVDGLIIVDCPPEEADPLSDALEAEGIALIRLAAPTTDDARLPMVVRRTSGFVYYVS
VAGVTGVKSADAAEVAPAVERLRKASGLPVAVGFGIRTPDQAAAVAQVADAAVVGSALVD
EIESAARLNENVTEKVLLKASELAKAVRSARVGTK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaagaccgtatcgaccgccgcttcgcggcgctgaaggccgagaaccgcgccggc
ttcgtgacctatgtcatggccggcgatcccgacgcggccacgacgctttcggtgcttaaa
ggcttgccggccgctggcgccgacctgatcgagctgggctttcccttctccgacccgatg
gccgaggggccgaccatccagcgcgcggctcagcgcggcctgaagtccggcatgaccctg
caaggaacgctggacctcgtcgccgccttccgcgaaggcgaccaggacaccccgatcatc
ctgatgggctacctcaatccggtcctgcaccggggcttcgagagcttcgcggacgccgcc
gccaaggccggggtcgacggcctgatcatcgtcgactgcccgcccgaagaggccgacccg
ctgtcggacgctcttgaggcggaaggcatcgccctgatccgcctggcggccccgaccacc
gacgacgcgcgcctgccgatggtggtgcgccgcacctcgggcttcgtctattacgtgtcg
gtcgccggggtgaccggcgtgaagtcggccgacgcggccgaggtcgcgcccgccgtcgag
cgcctgcgcaaggcctcgggcctgccggtggcggtgggctttggtatccgcacgccggat
caggccgccgccgtcgcccaggtggctgacgcggccgtcgtgggttccgctcttgtggat
gaaatcgaatccgcggctcggttgaacgaaaacgtgaccgagaaggttcttctaaaagcg
tcggagctggctaaggctgtgcgttcggcgcgagtcgggacgaagtga

DBGET integrated database retrieval system