KEGG   Caulobacter segnis: Cseg_0982Help
Entry
Cseg_0982         CDS       T01221                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
cse  Caulobacter segnis
Pathway
cse00040  Pentose and glucuronate interconversions
cse00053  Ascorbate and aldarate metabolism
cse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cseg_0982
   00053 Ascorbate and aldarate metabolism
    Cseg_0982
Enzymes [BR:cse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Cseg_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADG09487
UniProt: D5VIB3
Position
complement(1057506..1059089)
Genome map
AA seq 527 aa AA seqDB search
MHLTGQLLIGGESRKGTNGEIKGVNPATGEILEPAFGGATKADVDAAAALAHEAFAGYRA
LPYETRATFLESIAEHIEAIGDDLIVRTMAETGLPRPRLEGERGRTVGQLRLFAGVLRDG
GFLEARIDPALPDRKPLPRPDLRLRNVPLGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHPAHPGASELVGRAIQAAVAACGLHPGVFSMIHDSGYEVSQALVADPRVKAAGFT
GSRRGGLALLAIAQGRPEPIPFYAEMSSINPVIMLPAALKARGPQIAPDFVAALTLGAGQ
FCTNPGLILAIEGPELDAFVEAAGKAVEAAPASVMLTPGICKAFAHGVAALTEAKEVTTV
ARGIPGPDGSHTGRAALFSVAAKDFLANPHLHEEVFGAASVVVRAADQAELEKVVAAVEG
QLTIAIHMDEADHPIVAALLPTLEMKAGRILVNGFGTGVEVAPAMVHGGPFPATSDGRTT
SVGTLAIARFLRPVSYQNLPEALLPAELKTENPLGIARRVDGKVKVG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgcatctgaccggccagcttctgatcggcggcgaaagccgcaaggggaccaacggcgag
atcaagggcgtcaatccggcgaccggcgagatcctggagcccgcgttcggcggcgcgacc
aaggccgacgtcgacgcggccgcggccctggcccacgaggccttcgccggctaccgcgcc
ctgccctacgagacccgcgcgaccttcctggaatcgatcgccgagcacatcgaggcgatc
ggcgatgacctgatcgtccgcaccatggccgagaccggcctgccccgcccgcgcctggaa
ggcgagcgcggccgcacggtcggccagctgcgcctgttcgccggcgtgctgcgcgacggc
ggcttcctggaagcccgcatcgacccggcgctgccggaccgcaagccgctgccgcgtccg
gacctgcgtctgcgcaacgtgccgctgggcccggtggccgtgttcggcgcgagcaacttc
ccgctggccttctcggtggccggcggcgacaccgcctcggcgctggcggccggctgcccg
gtcatcgtcaaggctcacccggcccacccgggtgcctcggagctggtcggccgcgccatc
caggccgccgtcgccgcctgcggcctgcatccgggcgtgttttcgatgatccacgacagc
ggctatgaggtcagccaggcgctggtcgccgatccgcgcgtcaaggccgccggcttcacc
ggctcgcgccgcgggggcctcgctttgctggccatcgcccaaggtcgtcccgagccgatc
ccgttctacgccgagatgagcagcatcaacccggtgatcatgctgcccgccgccctgaag
gcgcgcggtccgcagatcgctccggacttcgtggccgccctgaccctgggcgcgggccag
ttctgcaccaatcccggcctgatcctggcgatcgaaggccccgagctggacgccttcgtc
gaggccgccggcaaggcggtcgaggccgcgccggcctcggtcatgctgaccccgggcatc
tgcaaggccttcgcccatggggtcgcggccctgaccgaagccaaggaagtgaccacggtc
gcgcgcggcatcccgggtcccgacggcagccacaccggccgcgcggccctgttcagcgtc
gcggccaaggacttcctggccaatccgcacctgcacgaggaagtgttcggcgcggcctcg
gtggtggtccgcgccgccgaccaggccgagctggagaaggtcgtggccgccgtcgagggc
caactgaccatcgccatccacatggacgaggccgaccatccgatcgtcgccgccctgctg
ccgaccctggaaatgaaggccggccgtattctcgtgaacggcttcggcaccggcgtcgag
gtggcgccggccatggtccacggcggtccgttcccggccaccagcgacggccgcacgacc
tcggtcggcaccctggccatcgcccgcttcctgcgcccggtcagctaccagaacctgccg
gaagccctgctgccggccgagctgaagacggagaacccgctgggcatcgcgcggcgcgtg
gatggcaaggtgaaggtgggctga

DBGET integrated database retrieval system