KEGG   Caulobacter segnis: Cseg_1376Help
Entry
Cseg_1376         CDS       T01221                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cse  Caulobacter segnis
Pathway
cse00010  Glycolysis / Gluconeogenesis
cse00052  Galactose metabolism
cse00500  Starch and sucrose metabolism
cse00520  Amino sugar and nucleotide sugar metabolism
cse00521  Streptomycin biosynthesis
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
cse01120  Microbial metabolism in diverse environments
cse01130  Biosynthesis of antibiotics
cse01200  Carbon metabolism
Module
cse_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cseg_1376
   00052 Galactose metabolism
    Cseg_1376
   00500 Starch and sucrose metabolism
    Cseg_1376
   00520 Amino sugar and nucleotide sugar metabolism
    Cseg_1376
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cseg_1376
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cseg_1376
Enzymes [BR:cse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cseg_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADG09869
UniProt: D5VIQ3
Position
1476755..1477750
Genome map
AA seq 331 aa AA seqDB search
MDGNHSGGLGLVGDIGGTNARFALVEFDGPDPRLIEPTTFKGEDYGTAEDAIEAYLHKVG
VKHADQAVVAVAGPIDHGQVHMTNLDWRISEDGLRRAGGFRNAKLINDFTAQALAAPRLA
PKDLRQIGALPTSGEGDLAILGPGTGFGVAGLVRRHGQELPLATEGGHVAFAPLDEVEIE
VLRLLTRQLNGGRVSVERILSGPGMEDLHVALGEAEGRKVETLTAKQITERAVEGCADSL
ATVNRFCAVLGSTAGDIALTLGARGGVFIAGGIAPRIIDILEKSPFRARFEAKGRLSSFT
QAIPTHVILHPHTALIGAAVALTPEGRAAVS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggacggcaatcacagcgggggtctcggcctcgtcggcgacatcggcggcacgaacgcc
cgcttcgccctggtcgagttcgacgggccggacccgcgcctgatcgagcccaccacgttc
aagggcgaggactacgggacggccgaggacgccatcgaggcctatctgcacaaggtcggc
gtcaaacacgccgaccaggcggtcgtggcggtggcggggcccatcgatcatggccaggtc
cacatgaccaacctggactggcggatctcggaggacgggctgcgtcgcgccggcggattc
cggaacgccaagctgatcaacgacttcaccgcccaggccctggccgcgccgcgtctggcg
cccaaggacctgcgccagatcggcgcgctgccgacgtcgggggagggcgacctcgccatt
ctcggtccgggcacgggcttcggcgtcgcgggtctggtccgccgccacggccaggagctc
ccgctggccaccgagggcggccacgtcgccttcgcgccgctggacgaggtcgagatcgaa
gtgctccgtctactgactaggcagctgaacggcggccgcgtctcggtcgagcgcatcctg
tctggccccggcatggaagacctgcacgtggcgctcggcgaggccgagggacgcaaggtc
gagaccctgaccgccaagcagatcaccgagcgcgccgtcgaaggctgcgccgacagcctg
gcgaccgtgaaccggttctgcgcggtgctgggctcgacggccggcgacatcgccctgacc
ctgggcgcgcgcggcggcgtcttcatcgccggcggcatcgcgcctcggatcatcgacatc
ctggaaaagagcccgttccgcgcgcgcttcgaggccaagggccggctgtccagcttcacc
caggcgatcccgacccacgtgatcctgcacccgcatacggcgctgatcggcgcggcggtg
gcgctgacgccggagggcagggcggcggtgtcctga

DBGET integrated database retrieval system