KEGG   Caulobacter segnis: Cseg_1541Help
Entry
Cseg_1541         CDS       T01221                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cse  Caulobacter segnis
Pathway
cse00450  Selenocompound metabolism
cse00970  Aminoacyl-tRNA biosynthesis
cse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Cseg_1541
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cseg_1541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cse01007]
    Cseg_1541
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cse03016]
    Cseg_1541
Enzymes [BR:cse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Cseg_1541
Amino acid related enzymes [BR:cse01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cseg_1541
Transfer RNA biogenesis [BR:cse03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cseg_1541
 Prokaryotic type
   Other AARSs
    Cseg_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1f zinc_ribbon_4 zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ADG10029
UniProt: D5VG26
Position
1637770..1639479
Genome map
AA seq 569 aa AA seqDB search
MARILITSALPYINGIKHLGNLAGSMLPADVYARFQRARGHETLYICATDEHGTPAELAA
AAANQDVATYCAEQHVLQHDVGRAFGLSWDHFGRSSSPQNHRLTQHFCQALEDHGLIEER
VDQMVYSVDDKRFLPDRYVEGTCPHCGFEKARGDQCDNCGNLLDPTDLIDPYSVISGSRN
IEVRDTRHLYLLQTKMADKIRAWVDSHADWPQLARSIAYKHLDEGLIDRGITRDLAWGIP
VAKDGAPRPGFEDKVFYVWFDAPIEYIAATQEWAEASPDRDWKRWWRTDAGAEDVRYVQF
MGKDNVAFHTVSFPATILGSEEPWKSVDMLKAFNWLNWYGGKFSTSNKRGVFMDAALDIL
PPDLWRWYLTANSPEGSDTAFTWEQFASAVNRDLADVLGNFVNRILKFTESKFDGVVPEG
GQPGPLEEKLFADVSARLADLAEQMDAIEIRKSAQALRALWVVGNEYLQEAAPWTAIKTD
RDRAAVIVRTALNLAALYAKISAPFIPFAAEKISEAFGLDFPAAWPSNDAAAELSKLAVG
QAITVPEVLFKKIDDDQIAEWTARFGGAD
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcatcctgatcacctcggctctgccgtacatcaacggcatcaagcacctgggg
aatctggcggggtcgatgctgccggccgacgtctatgcgcgcttccagcgggctcggggt
cacgagacgctctacatctgcgccaccgacgagcacggcacgccggccgagctggccgcc
gcggccgccaaccaggacgtcgccacctactgcgccgaacagcacgtgctgcagcatgat
gttgggcgggcctttgggctgtcctgggaccatttcggccgttcctcgtcgccgcaaaat
catcgcctgacccagcacttctgccaggccttggaagaccacggcctgatcgaggagcgg
gtcgaccagatggtctattcggtcgacgacaagcgcttcctgcccgaccgctatgtcgag
gggacctgcccgcactgcggtttcgagaaggcgcgcggcgaccagtgcgacaactgcggc
aacctgctggaccccaccgacctgatcgatccgtactcggtgatctccggctcgcggaac
atcgaggtgcgcgacacccgccacctctacctcctgcagaccaagatggccgacaagatc
cgcgcctgggtcgacagccacgccgactggccgcagttggcgcgctcgatcgcctacaag
cacctggacgagggcctgatcgaccggggcatcacccgggatctcgcctggggcatcccg
gtggccaaggacggggccccgcgcccgggcttcgaggacaaggtgttctacgtctggttc
gacgcgccgatcgaatacatcgccgcgacccaggagtgggccgaagcctcgcccgaccgc
gactggaagcgctggtggcgcaccgacgccggcgccgaggacgtccgctacgtccagttc
atgggcaaggacaatgtcgcgttccacaccgtcagcttcccggcgaccatcctgggttcg
gaagagccttggaagagcgtcgacatgctcaaggccttcaactggctgaactggtacggc
ggcaagttctcgaccagcaacaagcgcggcgtcttcatggacgcggccctggacatcctg
ccgcccgacctgtggcgctggtacctgacggccaattcgccggaaggcagcgacacggcc
ttcacctgggagcagttcgccagcgccgtgaaccgcgacctggccgacgtgctgggcaac
ttcgtcaaccgcatcctgaagttcaccgagagcaagttcgacggtgtcgtgcccgagggc
ggccagccgggcccgttggaagagaagctgttcgccgacgtctcggcgcgccttgctgac
ctggccgaacagatggacgctatcgaaatccgcaagagcgcccaggcgctgcgggccctc
tgggtggtcggcaacgagtacctgcaagaggccgcgccgtggaccgcgatcaagaccgat
cgcgaccgcgccgcggtcatcgtgcgcacggccctgaacctcgcggccctctacgccaag
atctcggcgccgttcatcccgttcgcggccgagaagatcagcgaggcgttcggcctggac
ttcccggcggcgtggccgtcgaacgacgccgcggcagagctctccaagctggcggttggc
caagcgatcacggtccccgaggtcctcttcaagaagattgacgacgaccagatcgccgaa
tggacggcccgtttcggcggcgcggactag

DBGET integrated database retrieval system