KEGG   Caulobacter segnis: Cseg_1639Help
Entry
Cseg_1639         CDS       T01221                                 

Definition
(GenBank) glycyl-tRNA synthetase, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
cse  Caulobacter segnis
Pathway
cse00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cse00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cseg_1639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cse01007]
    Cseg_1639
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cse03016]
    Cseg_1639
Enzymes [BR:cse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Cseg_1639
Amino acid related enzymes [BR:cse01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Cseg_1639
Transfer RNA biogenesis [BR:cse03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Cseg_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: ADG10124
UniProt: D5VJ36
Position
1749496..1750395
Genome map
AA seq 299 aa AA seqDB search
MSREKPKSFQSLILTLHDYWSRQGCVILQPHDVEVGAGTLHPATVLRALGPKPWNAAYVQ
PSRRPGDGRYGENPNRLQHYYQYQVILKPNPENMQDLYLGSLEAIGLDLRTHDIRFVEDD
WENPTVGAWGLGWEVWCDGMEVSQYTYFQQVGGLDVSPVAGELTYGLERLAMYVFGVDNV
YDLPFNDPDSPLGATTYGDVFLENERQQSEANFHGYDVAVLKQQFEQMEEQVPLMLARSY
QGKSLVLPAYDMVLKASHLFNLMNARGAIAVAERASYIGRIRDLCKMCASAWVEQQEAA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgaaaaacccaagtccttccaaagcctgatcctgacgctccatgactattgg
agccgccagggctgcgtgatcctgcagccgcacgatgtcgaggtgggggcggggacgctg
cacccggccaccgtgctgcgcgccttgggccccaagccctggaacgccgcctacgtgcag
ccctcgcgccgtccgggcgacggccgctatggcgagaaccccaaccgcctgcagcactat
tatcagtaccaggtgatcctgaagccgaaccccgagaacatgcaggacctgtacctgggg
tctctggaagcgatcggcctggacctgcgcacccacgacatccgcttcgtcgaggacgac
tgggagaacccgaccgtcggcgcctggggcctgggctgggaagtctggtgcgacggcatg
gaagtcagccagtacacctacttccagcaggtcggcggcctggacgtgagccccgtcgcg
ggcgagctgacctatggcctggagcgcctggccatgtacgtgttcggcgtcgacaacgtc
tacgacctgccgttcaacgatcccgactcgccgctcggcgcgacgacctatggcgacgtg
ttcctggagaacgagcgccagcagtcggaagccaacttccatggctatgacgtcgcggtg
ctcaagcagcagttcgagcagatggaggagcaggtgccgctgatgctggcccgctcctat
cagggcaagtcgctcgtcctgcccgcctacgacatggtcctgaaggccagccaccttttc
aacctgatgaacgcccgcggcgcgatcgccgtcgccgagcgcgccagctacatcggccgc
atccgcgacctttgtaagatgtgcgccagcgcctgggtcgagcagcaggaagccgcgtaa

DBGET integrated database retrieval system