KEGG   Caulobacter segnis: Cseg_2554
Entry
Cseg_2554         CDS       T01221                                 
Name
(GenBank) Lytic transglycosylase catalytic
Organism
cse  Caulobacter segnis
SSDB
Motif
Pfam: SLT Transglycosylas SLT_2 SLT_4
Other DBs
NCBI-ProteinID: ADG11008
UniProt: D5VKI5
Position
complement(2799108..2799737)
AA seq 209 aa
MATIASALTVCSEASGEGLAQVCALSAKPALMGQHLADASLRSGLPQALIRAVAEAESGG
AVHAISPKGAMGLMQIMPATWRDLRADLGLGDDPFDPRDNLLAGAVYLRRMLDRFGAEGF
LGAYNAGPSRYQAYLDGKQKLPAETIAYVARVRARLPKSASRKQTLGGRISPDWRGSDLF
VSSGGEAQESEFSAAKAPLFSGVAEEATR
NT seq 630 nt   +upstreamnt  +downstreamnt
gtggctaccatcgccagtgcgctgacggtgtgctcggaggctagcggggagggacttgct
caggtttgtgcgctctcggcgaagccagctttgatgggccagcatctggccgacgcatcg
cttagatcgggattaccgcaagctctgatacgcgcggtggcggaggccgaaagcggcgga
gcggttcatgcaatctcgccaaaaggcgcgatgggcctgatgcagatcatgcccgccacc
tggcgcgacttgcgggccgatcttggacttggagacgacccgttcgacccgcgcgacaat
ctcttggccggcgcggtctatctgcgtcggatgttggatcgcttcggcgcggagggtttt
ctgggcgcctacaatgccggtccttcgcgctatcaggcgtatttggacggcaaacaaaag
ctgcctgccgaaaccatcgcctatgtcgcgcgcgtgcgcgcgaggttgcccaagtccgcg
tcgcggaagcagacacttgggggacggatcagtccagattggcgcggatcggatctcttc
gtcagtagcggaggtgaggctcaagagtccgaattcagcgcggctaaggcaccactcttt
tctggtgtcgccgaggaggcgacgcgatga

DBGET integrated database retrieval system