KEGG   Caulobacter segnis: Cseg_3393Help
Entry
Cseg_3393         CDS       T01221                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cse  Caulobacter segnis
Pathway
cse00071  Fatty acid degradation
cse00072  Synthesis and degradation of ketone bodies
cse00280  Valine, leucine and isoleucine degradation
cse00310  Lysine degradation
cse00362  Benzoate degradation
cse00380  Tryptophan metabolism
cse00620  Pyruvate metabolism
cse00630  Glyoxylate and dicarboxylate metabolism
cse00640  Propanoate metabolism
cse00650  Butanoate metabolism
cse00900  Terpenoid backbone biosynthesis
cse01100  Metabolic pathways
cse01110  Biosynthesis of secondary metabolites
cse01120  Microbial metabolism in diverse environments
cse01130  Biosynthesis of antibiotics
cse01200  Carbon metabolism
cse01212  Fatty acid metabolism
cse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cseg_3393
   00630 Glyoxylate and dicarboxylate metabolism
    Cseg_3393
   00640 Propanoate metabolism
    Cseg_3393
   00650 Butanoate metabolism
    Cseg_3393
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cseg_3393
   00072 Synthesis and degradation of ketone bodies
    Cseg_3393
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cseg_3393
   00310 Lysine degradation
    Cseg_3393
   00380 Tryptophan metabolism
    Cseg_3393
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cseg_3393
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cseg_3393
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cseg_3393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cse04147]
    Cseg_3393
Enzymes [BR:cse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Cseg_3393
Exosome [BR:cse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cseg_3393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-ProteinID: ADG11826
UniProt: D5VMV3
Position
3720227..3721414
Genome map
AA seq 395 aa AA seqDB search
MSAADPVVIVSYARTPMGGFQGALGGVKATELGATAVKAAIERAGVSGDKVEQIIMGCVL
PAGLGQAPARQAALGAGLPLSVEATTVNKMCGSGMQAAIMAHDALAAGSVDLVVAGGMES
MTGAPYLMAKHRGGARIGHDQIWDSMYLDGLEDAYTPGKLMGAFAEDTAAQYQFTREAMD
AYATKGLAKAKSAIESGAFKGEIAPVTVQTRKGTEVVDTDEQPLKADPAKIPTLRPAFAR
DGGITAANSSSTSDGAAALVMTRESVAKALGLPIVARVAGHAAHAHEPGLFTTAPVPAMK
KALKKAGWSVEDVDLFEVNEAFAVVAMIAQQELGIPEDKLNVNGGACALGHPIGASGARI
LCTLIAALQARGGKKGLASLCIGGGEATAMAVELV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgatcccgtcgtcatcgtctcttacgcccgcacgccgatgggcggcttc
cagggcgcgctgggcggcgtgaaggccaccgaactcggcgcgacggcggtgaaggccgcc
atcgagcgcgcaggcgtctccggcgacaaggtcgagcagatcatcatgggctgcgtgctg
ccggccgggcttggccaggcgccggctcgccaggcggcgctgggcgcgggacttcccctg
tcggtcgaggcgaccacggtcaacaagatgtgcggcagcggcatgcaggcggcgatcatg
gcgcacgacgccctggcggccggctcggtcgacctcgtcgtggccggcggcatggagagc
atgacgggcgcgccgtacctgatggccaagcaccgcggcggcgcccgcatcggccacgac
cagatctgggactcgatgtacctggacggcctggaggacgcctacacccccggcaagctg
atgggcgccttcgccgaggacaccgccgcccagtaccagttcacccgcgaggcgatggac
gcctacgccaccaagggcctcgccaaggccaagagcgccatcgagagcggcgccttcaag
ggcgagatcgccccggtgacggtccagacccgcaaggggaccgaggtcgtcgacaccgac
gaacaaccgctgaaggccgatccggccaagatcccgaccttgcgcccggccttcgcccgc
gacggcggcatcacggcggccaacagctcgtcgaccagcgacggcgccgcggccctggtc
atgacccgcgagagcgtcgccaaggccctgggcctgccgatcgtcgcccgcgtcgccggc
cacgccgcccacgcccacgagcccggcctcttcaccaccgccccggtcccggccatgaag
aaagcgctgaagaaggcgggctggagcgtcgaggacgtcgacctgttcgaggtcaacgag
gccttcgccgtcgtcgccatgatcgcccagcaggaactcggcatccccgaggacaagctg
aacgtcaacggcggcgcctgcgccctgggccacccgatcggcgcgtccggcgcgcgcatc
ctctgcaccctgatcgcggccctgcaggcgcgcggcggcaagaagggcttggcgtcgctc
tgcatcggcggcggcgaggccacggcgatggcggtggagctggtctga

DBGET integrated database retrieval system