KEGG   Caulobacter segnis: Cseg_4126Help
Entry
Cseg_4126         CDS       T01221                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cse  Caulobacter segnis
Pathway
cse00040  Pentose and glucuronate interconversions
cse00052  Galactose metabolism
cse00500  Starch and sucrose metabolism
cse00520  Amino sugar and nucleotide sugar metabolism
cse01100  Metabolic pathways
cse01130  Biosynthesis of antibiotics
Module
cse_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cseg_4126
   00052 Galactose metabolism
    Cseg_4126
   00500 Starch and sucrose metabolism
    Cseg_4126
   00520 Amino sugar and nucleotide sugar metabolism
    Cseg_4126
Enzymes [BR:cse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cseg_4126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADG12536
UniProt: D5VPW3
Position
4521434..4522309
Genome map
AA seq 291 aa AA seqDB search
MKPVRKAVLPVAGLGTRVLPGTKTTPKELLNVVDRPILSYIVEEGRKAGIEHFVFVTGRS
KGAIEDYFDHQVELEAQLEAKGKTDILNQLRAELPKPGEMSFVRQMAPLGLGHAVWCARD
IIGDEPFAVMLPDVIVDAEPSALNQLIEVYNKVGGGNVVGVEEVPASETHKYGIVAPGKV
DGRVATMTGMVEKPPQGTAPSNWSIAGRYILQPEIFGLLASQEKGAGNEIQLTDSMAKLM
QQQAFHAYVYDGVTHDCGDKIGLLRANVALALKRPDLGAAARSAIEAALKA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgttcgtaaagccgtccttcccgtcgctggcctgggcacccgcgttcttccc
ggcaccaagaccacgccgaaggagcttctgaacgtcgtcgaccggccgatcctctcctac
atcgtcgaggaaggccgcaaggccggcatcgagcacttcgtcttcgtcaccggccgctcg
aagggcgcgatcgaggactatttcgaccaccaggtcgagctcgaagcccagctcgaggcc
aagggcaagaccgacatcctcaaccagctgcgcgccgaactgcccaagccgggcgagatg
agcttcgtgcgccaaatggccccgctgggcctgggccacgccgtctggtgcgcccgtgac
atcatcggcgacgagccgttcgccgtcatgctgcccgacgtcattgttgacgccgagccg
tcggcgctgaaccagctgatcgaggtctacaacaaggtcggcggcggtaacgtcgtcggc
gtcgaggaagtccccgccagcgagacccacaagtacggcatcgtcgcgccgggcaaggtc
gacggccgtgtcgccaccatgaccggaatggtcgagaagcctccgcaaggcacggccccc
tcgaactggtcgatcgccggccgttacatcctgcagcccgagatcttcggcctgctggcg
agccaggagaagggcgcgggcaacgagatccagctgacggactcgatggccaagctgatg
cagcagcaagccttccacgcctatgtctatgacggcgtcacccacgactgcggcgacaag
atcggcctgctgcgcgccaatgtcgccctggccctgaagcgtccggatctcggcgcggcc
gcgcgctcggcgatcgaggcggccctgaaggcctag

DBGET integrated database retrieval system