KEGG   Cynoglossus semilaevis (tongue sole): 103377446Help
Entry
103377446         CDS       T04866                                 

Gene name
enosf1
Definition
(RefSeq) mitochondrial enolase superfamily member 1 isoform X1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00051  Fructose and mannose metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103377446 (enosf1)
Enzymes [BR:csem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     103377446 (enosf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-GeneID: 103377446
NCBI-ProteinID: XP_008306481
UniProt: A0A3P8UDU7
Position
3
AA seq 436 aa AA seqDB search
MLPKIINVTVKDVRFPTSTEQHGSDAMHTDPDYSTAYVVLHTDSELKGFGFTFTLGKGTE
IVVCAVESLSRLVVGKSLEEIVRDFRGFYRLLTSDSQMRWLGPEKGVIHVATAAVLNAVW
DLWARAEGKPLWKLLVDMDPEQLVSCIDFRYITDVLTEKEAVDLLLKAQEGRQQREDQML
SEGYPAYTTSCAWLGYSDQQLQQLCADALRGGWTRFKLKVGADLEDDVRRCRLIRQMIGP
NNTLMIDANQKWDVDEAVSWVSRLAEFKPLWIEEPTSPDDILGHATISKALAPHGIGVAT
GEQCHNRVMFKQLLQASALQFVQIDSCRLGSVNENLAVMLMAHKFKVPVCPHSGGVGLCE
LVQHLILFDYICVSASLNNRMCEYVDHLHEHFTSPVVIKDAHYLPPKDPGYSCEMLDSSV
QRYQFPDGEVWLQMNK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccaaaataataaacgtgactgtgaaggacgtgaggtttccgacatctacggag
caacatggctccgacgctatgcacactgacccggattattctaccgcctacgtcgtcctg
cacacggacagtgaactcaagggattcggcttcacttttactttaggaaaaggcaccgaa
atcgtggtgtgcgcagtggaatctctgtcgaggctggtggttggaaaatccctggaggag
attgtgagggacttccgcgggttctaccgtctcctgaccagtgatagccagatgagatgg
ctgggaccagagaagggtgtgatccacgtggctacagctgcagtcctaaatgctgtgtgg
gacctgtgggcgagggcagagggcaagccgctgtggaaactgctggttgacatggatcct
gagcagcttgtttcatgcatcgacttcagatacattactgatgtcctgacagagaaggag
gctgtagacctcctcctgaaggcacaggagggcaggcagcagagagaggaccagatgctg
agtgagggttaccctgcctacaccacctcctgtgcctggctggggtactcagaccagcag
ctccaacagctctgcgcagatgctctccgcggcggctggaccaggttcaagctgaaggtg
ggcgccgacctggaggacgacgtccgcaggtgtcgactcatcagacaaatgatcggaccc
aacaacactctgatgatcgacgccaaccagaaatgggacgtggacgaggccgtcagctgg
gtgtcccgcctggctgagttcaaacctctgtggatcgaggagccaacgtctcctgacgac
atcctgggtcacgctacgatctccaaggctttggctccacacgggattggcgtggcaacg
ggcgaacagtgtcacaacagggtgatgttcaagcagctcctccaagcgtcagcgctgcag
tttgtccagatcgacagctgcagactgggcagcgtcaacgagaacttggccgtgatgctg
atggcccacaagttcaaagtgcccgtgtgtcctcactctgggggagtgggtctgtgtgaa
ctggttcaacatctgatcctcttcgactacatctgtgtgtctgccagtctgaacaacagg
atgtgcgagtacgtggaccacctccacgaacacttcaccagtcctgtggtgattaaagac
gcccactacctccccccaaaggatcccggttactcctgtgagatgttggactcatcggtg
cagagataccagtttcctgatggagaagtttggctgcagatgaacaagtga

DBGET integrated database retrieval system