KEGG   Cynoglossus semilaevis (tongue sole): 103377580Help
Entry
103377580         CDS       T04866                                 

Gene name
tiparp
Definition
(RefSeq) TCDD-inducible poly [ADP-ribose] polymerase
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103377580 (tiparp)
Enzymes [BR:csem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     103377580 (tiparp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE DUF3586 zf_CCCH_4 Torus
Motif
Other DBs
NCBI-GeneID: 103377580
NCBI-ProteinID: XP_008306667
UniProt: A0A3P8UJY3
Position
4
AA seq 720 aa AA seqDB search
MDKTLQILQKAADGVPDGISLDMMEEEEGFTEQPIVGLSDKIPLVKPYFKKKQRKLDAKC
LHRALEDPMLSTLLSTDTLVSGDGVFVLRNQPGRTAGNLCTAAVVKQNRLGQVCLKDSGA
AADSAAAAEVPALIAQDGDAEIADTTAELEETERRAEQSKITSSTPDSRCFQLKPALRAS
GNTVTIQPSGRDIPPLVTPRVPHQQRPNKSNDLSPSGTKGLRVKECTGVQKPTPLLLQPD
NGVLFQDKSEEASLDLVFELLTQLQYHTHQSDLVDICVDFLHGQCVFGNDCVHHHTVLPY
HWQIHRTSSQSWQSVADDSQEQLERLYCNPDNEQVRLKFQGRVFSLDFGAMRVCDLEFDR
IRRLTTPPTPMTTSTTSPNPPPSCHTVWKYYCRDNFGWREYSEPVVKLIEEASSRGLKEV
RFITLQNQYILNIKEGFQQNAIFGFRRQIRKRPMFLSSVMLMPHLQTLGGLSLPSLPCSS
SSSSSLSLSSSSVDLSSSHPLSPTTTNPPSLFPETWLPMMMNQDFLQVPVSREDRSYRTV
YSLFHKTVLETKYRIIKILRVQNPFLWEKYKRKKEYMSRRLSEMDRLLCERHLFHGTSAD
VVDGICKHNFDPRVCGKHATMFGQGSYFARKAVYSHNFSKRSSKGVHCMFLAKVLTGRFT
VGNPSMRRPPPLNPRDPSSDLYDSCVDNWMDPQIYVIFNDDQSYPYFIIHYEEVPSTVTV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggataaaactttgcaaattcttcagaaagccgcggacggcgtaccagacgggatctct
ctggacatgatggaggaagaggagggcttcacggagcagcccatcgtgggactctcggac
aaaattcctctggtgaaaccgtacttcaaaaagaagcaaagaaaattagacgccaaatgt
ctccaccgtgccctggaggatcctatgctctccactttactgagcacagacactctggtg
tccggggacggagtgtttgttctacggaaccaaccaggtcggactgcggggaacctttgc
acggcggccgtggtgaagcagaaccgcttgggccaagtgtgtcttaaagactcgggagcc
gccgccgattccgcggccgcggcggaggtgcccgctctgatagcccaggacggtgacgcg
gaaatagccgatactactgcggagctggaggagacggagcggcgagcggagcagtccaag
atcaccagctcaacccccgacagccgctgctttcagctgaaacctgccctcagggcaagt
gggaacacagtgactattcagccctcaggcagggatatacctcccctggttacaccccgg
gttcctcaccaacagaggccaaacaaaagcaatgacctctcaccctctgggactaaaggc
cttcgagtcaaagagtgcactggagtccagaaacccactcctctccttttgcagcctgac
aatggtgttctatttcaggacaaaagtgaggaggcctccctggacctggtgtttgagctg
ctcacccagctccagtatcacacacaccagtcagacctagtggacatttgtgtggatttc
ttacacggacagtgtgtttttgggaatgactgcgtccaccaccacaccgtcctgccttac
cactggcagatccacaggaccagcagtcagagctggcagagcgtagccgacgactcccag
gaacagctggagcgactgtactgcaaccccgacaatgagcaagtcaggctgaagttccag
ggaagagtgttttctctggactttggtgcaatgcgagtgtgtgatttggagtttgaccgc
atcagacgattgaccactccccccactcccatgaccacatccaccaccagcccaaacccc
ccacccagctgtcacacagtgtggaagtactactgcagagacaactttggctggagggag
tactctgagcctgtggtgaagctcatcgaggaggccagttcccgtggtctgaaggaggtg
cgctttattacactccagaaccagtatatcctcaacatcaaggagggcttccagcagaac
gccatctttggattcagacggcagatccgaaaacggcccatgttcctgtcctcggtgatg
ctgatgcctcatcttcagacactgggcggcctctccttaccatctcttccttgctcctcg
tcctcctcgtcctccttgtcgttgtcctcctcatccgtggacctgtcctcgtcacatccg
ctctcccccaccaccaccaacccgcccagcctttttccagagacctggctgcctatgatg
atgaaccaggactttcttcaggttccagtttctcgtgaagaccgcagctaccgcacagtg
tacagccttttccacaagaccgtgttggagaccaagtacaggatcatcaagatcctgcgt
gttcaaaaccccttcctctgggagaagtacaagagaaaaaaggagtacatgtcccgacgt
ctgtcagagatggaccggctgctctgtgagcgccacctcttccacggcacctcggcggat
gtggtggacggcatctgcaagcacaactttgacccgcgagtctgcggaaaacacgccacc
atgttcggccagggctcctacttcgcccgtaaggctgtttactcccacaacttctccaag
cggtcctccaagggtgtccactgcatgttcctggccaaagtcctcactggaaggtttact
gtaggaaatccatccatgcgacgacctccgcccctcaaccctcgagacccctccagtgac
ctctatgactcctgcgtggacaactggatggacccccagatttacgtcatcttcaacgat
gaccagagttacccctacttcatcattcactacgaggaggttcccagcactgtcaccgtc
tga

DBGET integrated database retrieval system