KEGG   Cynoglossus semilaevis (tongue sole): 103379072Help
Entry
103379072         CDS       T04866                                 

Definition
(RefSeq) histidine decarboxylase isoform X1
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00340  Histidine metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    103379072
Enzymes [BR:csem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     103379072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103379072
NCBI-ProteinID: XP_008308717
UniProt: A0A3P8VMR5
Position
5
AA seq 640 aa AA seqDB search
MQAEEYNRRGKELVDYITQYLVSIRERKVIPDVAPDYMRQLIPDTAPVEAEDWESIFKDI
ERVIMPGVVHWQSPHMHAYYPCLTSWPSMLGEMLADAINCVGFTWAASPASTELEMNVMD
WLCKALGLPNVFLHYHPDSRGGGILQSTVSESTLIALLAARKDKILELQAELDQEVDESV
LNARLVAYASDQAHSSVEKAGLIALVKVRFLSTDDQFSLRGDTLKQAILEDRRNGLVPFM
LCATLGTTAVCAFDKLSELGPVCQQEGLWLHVDAAYAGTAYFCPELRWSLEGIDLAHSFV
FNPSKWMMVHFDCTAFWVRDKYKLQQTFSVDPVYLRHENSQAATDFMHWQIPLSRRFRSL
KLWFVMRSFGLKKLQAHVRHGIEMAKLLESQIRNDPKFEVPAERHLGLVVFCLKGGNALT
QELLKKITRAGTMYLIPAEINNKRIIRFTVTSQFTTADDILKDWGIISKMASALLADKPE
NNDKAVTVQPKPREDGASGEDDQNERGATFRLEESQWELLIKKDWNVSRKTQRSLSCSYD
VWPGFKSDAAKPPQRPVKTGSSAGVKVTENPLGQEVLKKLTKFHSVPTFCHQLVQCGRQQ
MCFPKTPSQAAQENPSFRCMGAGVAPPTTPTEVHSAPKPQ
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgaagaatacaaccgcagaggtaaggagctggtggattacatcactcagtac
ctggtctccatcagggagaggaaagtcattccagacgtggcaccggactacatgaggcag
ctgatcccggacactgcccctgtggaagctgaggattgggagagtatcttcaaagatatc
gagagagtcataatgccgggggtggttcactggcagagcccacatatgcacgcctactac
ccctgcctgacctcgtggccctccatgcttggggaaatgctggctgatgccattaactgt
gtcggattcacttgggctgcaagtccagcttccacagagttggaaatgaatgtgatggac
tggttgtgtaaagcactggggctgccaaatgtcttcttgcattaccatccagacagcaga
ggtggaggaatcctgcagagtacagtcagtgaaagtacactgatcgctctgttggcagcc
aggaaagataaaatcttggagctgcaggctgagcttgaccaggaagtggatgaatctgtt
ctcaatgcaagactggtggcctacgcctccgaccaggctcactcttcagtggagaaggcg
ggtctgatcgctctggtcaaggtcaggttcctatccactgatgaccagttctctctgaga
ggagacactttgaagcaagccatacttgaagacagaaggaatggactggttcctttcatg
ctctgtgccactttaggaactacagcagtgtgtgccttcgacaagctctcagaactggga
cctgtgtgtcaacaggagggactgtggcttcatgtcgacgctgcatacgctggcacggcc
tacttttgtcccgagctacgctggtccctggagggcatcgacttggcccactctttcgtc
tttaatccatccaagtggatgatggtccattttgactgcacagcgttctgggtcagagac
aaatacaagctacagcagaccttcagtgttgatccagtttatctgcgacatgaaaactca
caagcagccacggatttcatgcattggcaaattcccctgagccgccgttttcgttctctc
aaactctggtttgtcatgcgttcctttggactgaaaaaactgcaggctcacgttagacac
ggcatcgagatggcaaagctcctagagtctcaaattaggaatgatcccaaatttgaagta
cctgcagagaggcacctgggcctggtggtcttctgtctcaaaggaggcaacgctttaacc
caggagttgttgaaaaaaataacccgggcaggtaccatgtacctcatccccgcagaaata
aataataaacgcatcatacggttcactgtgacctcacagttcactactgcagatgacatc
ctcaaagactggggcatcatctccaaaatggcttccgctcttctggcagataagccagag
aacaatgataaggcagtgacagtccaacccaaaccaagggaagatggtgcatcaggagaa
gacgaccaaaatgaacgtggtgccaccttcaggctggaggagtctcagtgggagctgctt
attaaaaaggactggaatgtatcgaggaaaacgcagcgttctctcagctgcagctatgat
gtttggccaggatttaaaagtgatgctgccaaaccacctcagaggccagtgaaaacagga
tccagtgctggagtgaaggttactgaaaatcctctgggccaagaggtcttgaagaagctg
accaagtttcacagtgtccccactttctgccaccagctggtgcagtgtggccggcagcag
atgtgcttccccaagacgccttcacaagcagctcaggaaaatccatccttcaggtgcatg
ggagccggtgtagcgccccccactactccaacagaagtccactctgcacccaaaccccag
tga

DBGET integrated database retrieval system