KEGG   Cynoglossus semilaevis (tongue sole): 103380400Help
Entry
103380400         CDS       T04866                                 

Definition
(RefSeq) dihydrofolate reductase-like
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00670  One carbon pool by folate
csem00790  Folate biosynthesis
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103380400
   00670 One carbon pool by folate
    103380400
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     103380400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 103380400
NCBI-ProteinID: XP_008310574
UniProt: A0A3P8VJT5
Position
6
AA seq 196 aa AA seqDB search
MEKSRDQVQKKPLRLIAAACNGMGIGKDGKVPWCLPREFQYFLDSITRVSRPGKLNLLIW
GKVCWFSNPELFPLSNVLHVVVSTKLTTTPDHAHFVTSDFESAVNLASERPLADLIETVW
VIGGRQMYEEGMKHPWCDLVYLTDIMADFDCDVFFPELDRKLFVLQNRFPDVACDIQEEN
GIKYKFQVFKKEVDNV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagccgggaccaagtgcagaaaaagccattgcgtctcatcgcagcagcctgt
aatggcatggggatcggcaaggacggaaaagtgccctggtgtttaccacgtgaattccag
tactttctagactccatcactagggtgtcaagaccagggaagttgaatttgttaatatgg
ggcaaggtttgctggttttccaacccggagctttttccgttatctaatgttctgcatgtg
gtggtgagcaccaaattaaccacgactcctgatcacgcccacttcgttacgtcagacttt
gagagtgcagtgaacttggcgtctgagcgtccacttgctgacctaatagaaaccgtctgg
gtgattgggggaagacagatgtatgaggagggcatgaagcatccatggtgtgacctggtt
tacctgactgatatcatggctgactttgactgtgatgttttcttccctgagcttgaccgg
aaactgtttgttcttcaaaacagatttcctgatgtagcatgtgacatccaagaggagaat
ggcatcaagtataaattccaagtgtttaagaaggaggtggataatgtgtag

DBGET integrated database retrieval system