KEGG   Cynoglossus semilaevis (tongue sole): 103380843Help
Entry
103380843         CDS       T04866                                 

Gene name
abhd12b
Definition
(RefSeq) protein ABHD12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csem01002]
    103380843 (abhd12b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103380843 (abhd12b)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103380843 (abhd12b)
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   103380843 (abhd12b)
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   103380843 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioesterase Abhydrolase_3 Peptidase_S9 FSH1 Abhydrolase_2 LIDHydrolase Lipase_3 LIP Peptidase_S15
Motif
Other DBs
NCBI-GeneID: 103380843
NCBI-ProteinID: XP_008311181
Position
1
AA seq 329 aa AA seqDB search
MSWMKTTVSSLITLYVSVPVLLFVFPWIVEHIIFAHLLTFPFFVDLSRPEDLLNNTYNFY
LSTEEDISVGVWHTLPASQWEQAVGKSPEWYQRTLGDGSPVIIYLHGNGGNRAMKHRVEL
MKIMSAADYHVLSLDYRGFGDSTGEPSEAGLTTDALYLYQWVKQQSRDSFVCLWGHSLGS
GVATNVAVKLQEQGSAPDAVILQGAFTNMEETIFNHPITKLYLFLPGFESLMWNILGRNN
VVFANDENVKTLTSPFLILHAEDDNIIPYHMGLQLYKTLLQTQEKHSTEAPVEMISYRAE
LGFSHNRIYLDPNLSNVVKGFLRKLRLHH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggatgaagacgacagtgtcctctctgattacactctatgtgtcagtgcctgtg
ctgctcttcgtgttcccatggatcgtggaacatatcatatttgctcacctattgactttt
ccattctttgtggacctcagcagacctgaagaccttctcaacaacacatacaacttctac
ctgagcacagaggaggacatctcagtgggagtctggcacactctccctgccagccaatgg
gagcaggctgtggggaaaagccctgagtggtaccagaggacgctgggggatggctctcct
gttattatctacctccatggaaacggaggaaacagggccatgaaacacagagtggagctg
atgaagatcatgagtgcagcagactaccatgtcctttctttagactacagaggttttgga
gactccactggtgaaccaagcgaggctggactgactactgacgccctctacctgtaccag
tgggtgaagcagcaaagcagagacagttttgtctgtctgtggggacactcacttggctca
ggtgtggctacaaatgttgctgtaaaactacaagaacaaggatctgcccctgacgcagta
atactgcaaggtgctttcacaaatatggaagaaaccattttcaaccatcctatcaccaag
ttgtacctgttcctcccaggatttgagagcctgatgtggaacatcctggggaggaacaac
gtagtgtttgctaatgatgaaaatgtgaagaccttgaccagtccatttcttatactgcac
gcagaggacgacaacattattccttatcacatgggtctacagttgtacaagactttactc
cagactcaggaaaaacacagcacagaggctccggttgaaatgatctcctacagagctgaa
cttggattctcacacaacaggatttacttggatcctaacctctccaatgtggtcaaaggt
tttcttcgtaagctgaggctgcaccattga

DBGET integrated database retrieval system