KEGG   Cynoglossus semilaevis (tongue sole): 103381296Help
Entry
103381296         CDS       T04866                                 

Gene name
arg2
Definition
(RefSeq) arginase-2, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00220  Arginine biosynthesis
csem00330  Arginine and proline metabolism
csem01100  Metabolic pathways
csem01230  Biosynthesis of amino acids
Module
csem_M00029  Urea cycle
csem_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103381296 (arg2)
   00330 Arginine and proline metabolism
    103381296 (arg2)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     103381296 (arg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 103381296
NCBI-ProteinID: XP_008311803
UniProt: A0A3P8VK33
Position
1
AA seq 350 aa AA seqDB search
MALRGPVSCLLRTLLSRSQKQQIRAQSVAVLGAPFSRGQKRRGVEHGPKVIRDAGLIERL
SGLDYSVHDFGDLNFPHIEKDEPYMEVKFPRNVGAANKILSGAVSRAIGAGHTFVMLGGD
HSLAIGSVSGHAQQCPDLCLVWVDAHADINTPVISPSGNLHGQPVAFMLKELQSKMPSLP
GFSWMKPFLSSRDLVYIGLRDVDPGEHHILKDLGIQYFTMRDIDRLGIQRVMEATLDHLL
ARKQRPIHLSFDIDAFDPSLAPATGTPVNGGLTYREGIYITEEIHNTGLLSAMDLVEVNP
MLGANPEAVEATASLAVDVIASSLGQTREGAHGSNMEIPSAKDDTEQLCL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctttgagaggaccagtgtcctgtcttctcagaactcttcttagccgctcacagaag
cagcagatccgggctcagtcagttgccgtacttggcgctcctttttcccgaggacagaaa
aggagaggtgtggagcacggacctaaggtgatcagagacgctggactcatcgagcggctc
tccgggttagactattccgtccatgactttggagacctgaactttccccacattgagaag
gatgaaccttacatggaagtgaagttcccccgaaatgtgggggcagccaacaagattctg
tccggcgctgtgagcagagccattggtgctggacacaccttcgttatgctcggaggtgac
cacagccttgctattggatcggtgagcggccatgctcagcagtgtcctgacctgtgtctc
gtctgggtggacgctcatgccgacatcaacacacctgtgatttctccatcaggaaacctc
catggtcaacctgtggctttcatgctcaaagaactgcaaagcaagatgccgtcactccct
ggcttttcctggatgaagccgttcctctcctccagggacctggtgtacatcggtctgcgg
gacgtggaccctggagagcatcacatcctgaaagacctgggaatccagtatttcacaatg
agggacattgacagactgggaatccagagagtgatggaagctactctagaccaccttttg
gcaagaaaacagcgcccaatccacttgagcttcgacatcgatgcctttgacccgtcgctg
gctccggccacaggaacaccggtgaacggaggtttgacctacagggaggggatctacatc
acagaggaaattcacaacacaggcctgctgtcagccatggacctggtagaagtcaacccc
atgctgggggccaaccctgaagccgtagaggccactgcctcgctcgcggtcgatgtcatt
gcctcgtctttgggacagacgagagagggcgcccacgggtccaatatggagattccgtca
gcaaaggacgacacagagcagctctgcctctga

DBGET integrated database retrieval system