KEGG   Cynoglossus semilaevis (tongue sole): 103381599Help
Entry
103381599         CDS       T04866                                 

Definition
(RefSeq) band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csem02000]
    103381599
   04147 Exosome [BR:csem04147]
    103381599
   04090 CD molecules [BR:csem04090]
    103381599
Transporters [BR:csem02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   103381599
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103381599
CD molecules [BR:csem04090]
 Proteins
  103381599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto Pox_LP_H2
Motif
Other DBs
NCBI-GeneID: 103381599
NCBI-ProteinID: XP_008312250
Position
8
AA seq 841 aa AA seqDB search
MKELKQQNNMLDTGHWGHCEDSFDPQAGTWVSPQISYLSFKSLIQLRRSMNTGVMIFDCE
EKTLADIAEKIVSEMVNKKEIRPENREDMVKVLLQNHSQSADPESQALTEGTNLQRISVK
ERKDVSDRDEVSLVLVGGLDFLEKPTVVFVRLKEALVLDSGLESPAPVRFIYVLVGPIKT
DVDYHETGRAMAALMADKVFHQTAVQAKSTKGLTDSMTNFMDCSVVIPPTEIQNEATLSS
IISFQEKLLQGRLKLDDSTVCLMPQPRRVSFTTKPPTEDPLSRTGRPFGGMIRDIKRRYK
YYKSDITDALNSQVLAAVIFIYFAALSPAITFGGLLADKVDNMMGVPELLISTSIQGIIF
CFLAAQPILVIGFSGPLLVFEEAFCAFCKSQDIEYIVGRVWVGVWLVIIVLVIVALDGSV
LVRFISRFTQEIFSILISLIFIYETFAKLGRIFKAHPLILNYDQLNASVENPWQPKSEER
VIYDNATGNTTVLVSTIKPPYPNTALLSMCLMFGCFFIAFFLRQFKNGTFLPGKVRRLIG
DFGVPIAIFLMIVVDYSIQDTYTQKLVVPKGLTVSNPAKRGWLINPFGEHQSFPVWLMFA
SCIPALLVFILIFLESQITTLIISKPERKMVKGSGFHFDLLLLVAMGGLSAIFGVPWLSA
ATVRTVTHANALTVMSKGPKPVIEKVMEQRVSGILVALLVGLSILMEPILTLIPMSALFG
IFLYMGVTSLNGIQLWDRMLLLFIPKKYHPDEPYATKVSTARMHVFTLIQCGCLVILWIV
KSSPASLALPFILILTIPLRMVMTGRLFSELEIKCLDADDAKVTFEEEPGQDVYCETQMP
L
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactaaagcagcagaacaacatgctggacacaggccactgggggcactgtgag
gacagctttgacccacaggcaggcacctgggtgtccccacagatatcctatctcagcttc
aagagcctcattcagctcagacgcagcatgaacacaggtgtaatgattttcgactgcgag
gagaagactttggccgacattgctgaaaagatcgtcagcgaaatggttaataaaaaggaa
atcaggccagaaaaccgtgaagacatggtgaaggttctgctccagaaccacagccaatca
gcagacccagagagccaagctttgacagagggtacaaatctacagagaatctcagtaaaa
gaaaggaaggacgtgtctgaccgtgatgaagtctccttggtgttagtaggaggtctggac
tttctggagaagcccacagtcgtgtttgtccgtctaaaggaggccttggtgcttgactcc
ggtctggagtccccggcaccagttcgcttcatctatgttctggttggcccaatcaagact
gacgtagattaccacgaaactggccgtgctatggcggcacttatggctgacaaagtgttc
catcaaacagccgtgcaggcgaagagcaccaaagggttgacggactccatgacaaatttc
atggattgcagcgttgtcattccaccgactgaaatccaaaatgaagcaacgttgagctcc
attatcagtttccaggagaaactactgcagggcaggcttaaacttgatgactccacagtt
tgcctgatgccccaacctcgtagggtgtccttcaccaccaaacctcctacagaggacccg
ctgtcccgtacggggcgtccgtttggtggaatgattcgggacataaaaagacgctacaag
tactacaagagtgacatcacagatgctctgaactcccaggttcttgctgcagttatcttt
atctactttgctgccctgtctcctgccatcaccttcggcggtcttttggctgataaggtg
gacaacatgatgggcgtcccagaacttctcatttccaccagtatccagggaatcatcttc
tgttttcttgccgcacagcccatactggtcatcggtttctctggtcctctcttagtgttt
gaggaggccttctgtgcattctgcaagtcccaggacatcgagtatattgtagggagagtg
tgggtcggagtgtggctcgtgatcatcgtgttggtgattgtggccctcgatggcagcgtc
ctggtgcgcttcatctcgcgcttcacccaagaaattttctccatacttatctccctcatc
ttcatctacgagaccttcgccaagctggggcggatcttcaaagcacacccgctcattctg
aattacgatcaattgaacgcaagcgtggaaaatccctggcaaccgaaatcggaagaacgc
gtcatttatgacaacgctacgggcaacacgactgtgctcgttagcaccattaagcctcct
tatcctaacacggctctgctctccatgtgcctcatgttcggttgtttctttatcgccttt
ttccttcgccagttcaagaacggaacgtttctgcccggaaaggtcagacgtttgattggt
gactttggagtccctattgcaattttccttatgatcgtggtggactacagtattcaggac
acctacactcagaaactggttgttccgaaaggtctgacagtgtccaacccggccaaaaga
ggctggttgatcaatccatttggagagcaccagtcctttcctgtgtggctcatgtttgcc
tcctgtatcccagccctgcttgtctttatcctcatctttctggagtctcaaatcactact
ttgattataagtaaacccgagaggaagatggtcaagggctccgggttccactttgacctg
ctgcttctagtagccatgggtggactcagtgcaatattcggtgtgccgtggctcagtgcc
gccactgtgagaacggtcacccacgccaacgccctcactgtcatgagcaaaggaccaaag
cctgtcatagagaaagtgatggaacagagagtcagcgggattctggtggccctgctagtt
ggtttgtctattctgatggagccgattctaacgttgatcccaatgtcagccctgtttggt
atcttcctttacatgggagtgacatcactgaatggtatacagctatgggatcggatgctt
ctgttgttcattcctaagaaataccacccggatgaaccctacgctaccaaagtaagcaca
gcacggatgcacgtgttcacgctcatccagtgtggctgccttgtgatcctttggattgtg
aagtccagtccagcatctctggcacttccatttatactgatcctcaccattcctttgcgc
atggttatgactgggcgtttgttctcagaactggaaattaaatgcttggatgctgacgat
gctaaagtgacatttgaggaggaaccaggccaggatgtatactgtgaaactcaaatgcca
ttgtaa

DBGET integrated database retrieval system