KEGG   Cynoglossus semilaevis (tongue sole): 103381768Help
Entry
103381768         CDS       T04866                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00260  Glycine, serine and threonine metabolism
csem01100  Metabolic pathways
csem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103381768
Enzymes [BR:csem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     103381768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 103381768
NCBI-ProteinID: XP_008312508
Position
8
AA seq 434 aa AA seqDB search
MTLNAVLSRRLFTLFTHGSPSLSVASWKSHFGLDAATSQGRSSTRCYYQTAKPRYPVPKK
ASHVRVVDLRSDTVTKPGAAMRQAIAEAEVGDDVMGEDPTVNELQRIAADMFGMEAALFV
PTGTMSNLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHATTATTRPDGTFDLE
QLESKIRHGYPDPHYPRSRLICVENTHNIQGGRVLPLSFLQEVRALADRHGLSVHMDGAR
LMNAAVAQGVAPSTILQHTDTVSVCLSKGLGAPVGTMLAGPRDFIDQALRCRKALGGGMR
QAGVLAAAGKIALLDMVGRLKEDHQNAKTFAQALLDCEPAVFSVDLAAVETNILRFCLKQ
KSWTPSEFCELMAQVCEGEEAELGQEIRVLMYPHFGNSVRAVWHLGISYEDTQLAVQKMH
FVTSQLLKKNNRSS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaacgcagtattgtcgcgtagattgtttaccttattcacccatggtagccca
agtctctcagtcgcttcgtggaaatcacatttcggtctggatgcagcaacgtcgcaggga
cgaagctccactcggtgttactaccaaacagcgaagccccgctaccccgtgccgaaaaag
gcgtctcatgtccgggtagtggacctccgcagtgacacagtgaccaaacccggagctgcg
atgcgtcaggccattgctgaggctgaggttggggacgatgtgatgggagaggacccgaca
gttaacgagctacagagaattgctgctgatatgtttgggatggaggccgcgctgtttgtc
cccacaggaaccatgagtaacctcatcgcagtaatggtacactgtcgtgagcgtggcgac
gagatgattgtgggcgatctgtctcatttacacatctacgagcagggaggaagtgcacag
ctggctggtgttcacgccaccacagctaccacacgtcctgatggaaccttcgacttggag
cagctggagtcaaagatccgccatggttacccagatcctcactaccctcgctctcgcctt
atatgtgtggagaacacgcacaacatccagggaggacgcgttctgcccctgagcttcttg
caggaggtccgtgctttagcagacagacacggtctgtcagttcacatggacggagccagg
ttgatgaacgccgcagtggcccagggagtggctccatccaccatcctgcagcacacagat
actgtcagcgtgtgtctctctaagggactgggggcccctgtgggcaccatgctggccgga
ccccgtgactttatagatcaggcgctgaggtgtcgtaaagctctgggtggggggatgagg
caggctggagttctggctgctgctgggaaaatagctttactggacatggtgggaagactg
aaggaggatcatcagaatgcaaaaacctttgctcaggctctgctggactgtgagcctgca
gtgttctctgtagacctggcggccgtggagacgaacattttgcgcttctgtttaaaacag
aaaagttggactccctctgagttttgtgaactcatggctcaggtttgtgaaggagaggaa
gctgaactgggacaagagataagagttctaatgtatcctcattttggaaactcagttcgg
gccgtgtggcatcttgggatatcatatgaagatactcagctggccgtccagaagatgcat
tttgttacttctcagcttttaaagaaaaacaatagatcttcctaa

DBGET integrated database retrieval system