KEGG   Cynoglossus semilaevis (tongue sole): 103381857Help
Entry
103381857         CDS       T04866                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like isoform X2
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103381857
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csem03041]
    103381857
Enzymes [BR:csem01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103381857
Spliceosome [BR:csem03041]
 Complex C
  Other components
   Step II factors
    103381857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 Flavi_DEAD T2SSE AAA_19 AAA_30 AAA_16 DUF2075
Motif
Other DBs
NCBI-GeneID: 103381857
NCBI-ProteinID: XP_008312639
Position
8
AA seq 1092 aa AA seqDB search
MRSTPSTSKGEKDKLKEKYPALCKPDDPVWMIPPSTTDNNDAEVAAAAMKQLEMLMPNVS
RIISDNSDRGREADRATGCKRGRSRSRSRERVGETIHKRRRKRPSRWSDCPPSPVKDKVE
EERCPDRPLAHPLPEEPVMGDIYDGKISSIMQFGCFVQLEGLRKCWEGLVHVSELRKEGR
VANVADVVANGQKVKVKVLLFTGSKTSLSMKDVDQETGEDLNPNRRKNLEPGVREEVLRN
PDQPTQASVLELEENSSEHKRLTKITDLEKWEIKQMIAANVLAKEEFPEFDEETGILPKI
DDDEDQDVEIDLVEEEPPFLRGQTKWTLNMSPVRIVKNPDGSLSQAAMMQSALSKERKEQ
KQAMRAAEMDCIPTGLNKNWIDPMPDYEGRQIAANMRGIVAAMPIDLPEWKRYALGGNQV
SYGKKTELSILQQRASLPIFKLKAELIQAVHDNQILIVVGETGSGKTTQITQYLAEAGYT
ARGKRGSTQPGRVAAMSVAKRVSEEFGCRLGQEVGYTIRFEDCTCTETVIKYMTHGMLQR
ECLIDPDMSQYGVIMLDEAHERTIHTDVLFGLLKKTIQKRKDLKLIVSSATLDAVKFSQY
FFEAPIFTIPGRTFPVEILYTREPETDYLDASLLTVMQIHLTEPPGDILVFLTGQEEIDT
ACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFNPAPPGSRKVIIATNIAETSLTI
DGIFYVVDPGFVKQVVYNSKTGIDQLLVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAH
RDEMLVSNVPEIQRTNLASTVLSLKAMGINDLLAFDFMDAPPMETLITAMEQLYSLGALD
DEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNIFYRPKEKQAQA
DQKKTKFFQPEGDHLTLLAVYNSWKNNKFSNPWCFENFIQGRSLKRAQDIRKQMLSIMDR
HKLDVVSCGKNTVRVQKAICSGFFRNAARKHPQDGYRTVIDQQVVYLHPSSTLFNRQPEW
LVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFRIADPTRLSRQKRQQKLEPLYNRYEEP
NAWRISRAFRRR
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atgcggtccacgccgtctacgagtaaaggtgagaaggacaaattgaaggagaaatatcct
gctttatgtaaacctgatgaccctgtgtggatgattcctccttctaccacagacaacaat
gatgcagaggtggctgcagctgcaatgaagcagttggaaatgctgatgcctaatgtcagt
agaataatctcagataacagtgacagaggtcgagaagcagacagagcaactggatgtaag
cgaggtcgatctcgttccagatcaagagaacgtgtgggcgagaccattcacaaacgtaga
aggaaaagaccatctcgctggagtgactgtccaccaagtccagtcaaagacaaggtggag
gaggagcgctgtcctgatagaccgttagctcaccctctgccagaagagccagtcatggga
gacatctatgacggcaaaatcagtagtattatgcaatttggttgtttcgtgcagctggaa
ggcctcaggaaatgctgggagggtctggtgcatgtatcagagctgcgcaaagaagggcgt
gtagcaaatgtggctgatgtggtagccaatggtcaaaaagtgaaggtcaaagtgctgctg
tttacaggaagcaaaacaagcctcagcatgaaggatgttgaccaggagacaggagaggac
ctgaaccccaaccgacgaaaaaaccttgaacctggagttagagaggaagtcttaagaaac
cctgaccagcccactcaggccagcgtgctagaactagaggaaaactcctcagaacacaaa
cgtctgaccaaaataactgacctggaaaaatgggaaatcaaacagatgattgcggcaaat
gttcttgctaaagaggagtttcccgagtttgatgaggagacgggaatccttcccaaaata
gatgatgacgaagatcaagatgtagagattgatctggtggaagaagagccaccattcctc
agaggacaaaccaagtggactttgaacatgagtccagtcagaatagtgaagaatcctgat
ggctccctctcccaggcagccatgatgcaaagcgctctctctaaggagaggaaagagcag
aagcaggcgatgcgtgcagcagagatggactgcatccctactgggctaaacaagaactgg
atcgacccaatgcctgattatgaaggaaggcagattgctgccaacatgagaggcatcgta
gcggcaatgcccattgatcttccagagtggaagagatatgccctcggaggaaaccaggtg
tcgtacggcaagaagacagaactgtccatcctgcagcagagagcgagtctgcctattttc
aagctcaaggcagagctcattcaggctgttcatgacaatcagattctgattgtagttgga
gaaactgggtctggtaagaccacacaaatcactcagtatctggcagaagcgggctacaca
gccagggggaagaggggctccactcagcccggtcgtgtagcagccatgtcagtggccaag
agagtctctgaggagtttgggtgccgtctgggtcaagaggtgggttacactatccgtttt
gaagactgcacctgtacagagacggttatcaagtacatgacccacggcatgctgcagagg
gagtgtctgatcgacccagacatgagtcagtacggagtcatcatgctcgacgaggcccat
gagagaacaattcacactgatgtgctgtttggtctgttgaaaaagacgatacagaaacgc
aaagacttgaagctgattgtgtcctctgctacactggatgccgtcaaattctcccagtat
ttctttgaagcccccatcttcacaatcccaggaagaactttcccagttgaaattctctac
accagagagccagagacggactacctggatgccagtctcttaacggtcatgcagatccac
ttgacagaaccaccaggtgacatcctggtgtttctaactggacaggaggagattgacacg
gcctgtgagatcctttatgaacggatgaagtcactgggccctgatgttcctgagctgatt
attctgccagtttattctgctctgcccagtgagatgcagaccaggatctttaatcctgca
cctccaggcagcagaaaggtcatcatcgccacaaatattgccgagacgtctctgaccatt
gatggtatcttctatgtagtggacccaggttttgttaagcaggtcgtatataattccaag
actggcatcgatcagcttctggtgaccccgatatcacaggcacaagcaaagcagaggtcg
ggtcgagctggcaggacaggccccggaaagtgctacagactctacacagaaagagcccac
agagatgaaatgctagtgtccaacgttccagagatccagaggacaaacttggccagcact
gtgctgtctttaaaggccatgggtatcaatgacctcctggcctttgacttcatggatgct
cctcccatggagactttgatcacagctatggagcagctgtactcactgggagctctggat
gatgagggtttactgacaaggctgggcagaaggatggcagagtttcctcttgaacccatg
ctgtgtaagatgttgattatgtctgtccacctgggctgcagtgaagagatgctcaccata
gtgtcaatgctgtctgttcagaacattttctacagacctaaggaaaagcaggcccaggct
gaccagaagaagaccaaattcttccagcctgagggagaccacctcactcttttggcggtt
tacaactcctggaagaacaacaagttctctaacccctggtgtttcgagaacttcatccag
gggagatcccttaagagggctcaagacattcgaaaacagatgctgagcatcatggacagg
cataagttggacgtggtttcttgcggaaaaaatacagtgcgagtccaaaaagcgatctgc
agcggtttcttcagaaacgcggccaggaagcatcctcaggacgggtatcgtaccgttatt
gaccagcaggtggtgtacctgcacccgtccagcacgctcttcaaccgacagcctgagtgg
cttgtgtaccacgagttggtactgaccactaaagagtacatgagggaggtgaccaccatc
gatccccgctggttggtggagtttgctccagccttcttcagaattgccgaccccactcgc
ctcagcagacagaagaggcagcagaaactggaacctctctacaaccgatacgaagaaccg
aacgcttggagaatctctcgtgcctttaggcgacgatga

DBGET integrated database retrieval system