KEGG   Cynoglossus semilaevis (tongue sole): 103381932Help
Entry
103381932         CDS       T04866                                 

Definition
(RefSeq) glutathione peroxidase 6-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00480  Glutathione metabolism
csem00590  Arachidonic acid metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103381932
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103381932
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103381932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103381932
NCBI-ProteinID: XP_008312764
UniProt: A0A3P8WHY9
Position
8
AA seq 130 aa AA seqDB search
MEMFGDNTFTVLGFSCNQFGLQSPEANHETLNVLKYVRPGGGFVPKFPVFGKVEVNGLNE
DPLFAYLKESLPFVNPVIGDIKKLYWSPIKVSDIPWNFEKFLITADGLPFRRYDLHSPIK
KVEEDILQML
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtttggcgacaatacctttactgtcttaggattctcctgcaaccaatttggt
cttcagtcacctgaggccaatcatgaaacccttaacgtactaaagtatgtgagacctggc
ggtggttttgtgccaaagtttcctgtctttggcaaagtggaggtgaatggattaaatgaa
gaccctctttttgcctaccttaaggaatctttgccatttgtaaaccctgttattggagac
atcaagaaattgtattggtccccaatcaaagtcagtgacattccatggaattttgaaaag
tttctcattactgcagatggtctgccctttagaaggtacgaccttcactctcccatcaag
aaagtggaagaggacatactgcaaatgctatga

DBGET integrated database retrieval system