KEGG   Cynoglossus semilaevis (tongue sole): 103382197Help
Entry
103382197         CDS       T04866                                 

Gene name
wdr45b
Definition
(RefSeq) WD repeat domain phosphoinositide-interacting protein 3
  KO
K22991  WD repeat-containing protein 45
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103382197 (wdr45b)
Membrane trafficking [BR:csem04131]
 Autophagy
  Other autophagy associated proteins
   Others
    103382197 (wdr45b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 PHTB1_N DUF1513 DUF3761
Motif
Other DBs
NCBI-GeneID: 103382197
NCBI-ProteinID: XP_008313120
UniProt: A0A3P8UM72
Position
8
AA seq 344 aa AA seqDB search
MNLLPSNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEML
FRCNYLALVGGGKKPKYPTNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMI
KVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHSGHVQIVDLANTEKPPVD
IPAHEGSLCCIALNLQGTRIATASEKGTLIRIFDTAAGQLIQELRRGSQAANIYCINFNQ
DASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCVCA
FGTEPNAVIAICADGSYYKFLFNQKGECSRDVYAQFLEMTDEKI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattaccatcgaatcctcatgggaacgggctcttgtacgctggatttaaccag
gatcacggatgttttgcctgtgggatggaaaatggattccgtgtgtacaacacagatcca
ctcaaggagaaggagaaacaagagttcctggagggcggggtcggacacgtggagatgctg
ttcagatgtaactacctggctctggtgggaggagggaagaaacccaaatatcctacaaac
aaagtgatgatctgggacgacctgaagaagaagacagtcattgagatcgagttctccact
gaggtcaaagcagtgaagcttcgtcgtgacaggattgttgtggtcctggactccatgatc
aaagtcttcacatttacccacaatccccatcagctgcatgtgtttgagacctgctacaac
cccaaaggactctgcgtcctgtgtcccaacagtaacaactccctgctggcctttcctggg
acccactcgggccacgtccagatcgtggacctggccaacacagagaaacctcctgtggac
atcccggcccacgagggctcactgtgctgcattgctctcaacctgcagggaaccaggatc
gccacggcctcagagaagggaactctgatcagaatctttgacacggctgcaggtcagttg
atccaggagctgagacgagggtctcaggctgccaacatttactgcatcaacttcaaccag
gatgcctccctgatctgtgtgtccagtgaccacggcaccgtccacatctttgctgccgaa
gaccccaagaggaacaaacagtccagtttggcctcggccagttttctccccaaatacttc
agctcaaagtggagtttctctaagttccaggttccttcaggttctccgtgtgtctgtgcc
tttggaacagaaccgaacgctgtcattgccatctgtgctgacggcagttactacaagttc
ctgttcaaccaaaagggggagtgctcacgggacgtgtacgcccagttcctggagatgacc
gatgaaaagatttga

DBGET integrated database retrieval system