KEGG   Cynoglossus semilaevis (tongue sole): 103383261Help
Entry
103383261         CDS       T04866                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00232  Caffeine metabolism
csem00983  Drug metabolism - other enzymes
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    103383261
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103383261
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     103383261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 103383261
NCBI-ProteinID: XP_008314534
Position
9
AA seq 289 aa AA seqDB search
MNLQEYFAKIGFQGSNAKPDLATLRQIHRQHVMVIPFENLSIHCGERITLDLQVIFDKEV
RSNRGGCCLENNCLFNWVLREMGYDVTMLGARVFDTDTNDFTATEDHLINKVVIDGRAYI
ADVSFGMSSQILEPLELISGKEQPQPVAVFRLVEEGETWVLEKTSRKKVTAAEFSDSPLI
DKKPSGKIYCFSLAPRQVDHFLEFNHSLQTDPDSLFTNKSICSLQTPTGFRGLVGLSYSQ
VTFKPEEGVDLIDMQDIPEEEVERILWEKFGVKLQNKLKPVNQKASFTL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcaggaatattttgcaaaaattggtttccaaggctcaaatgcaaaaccggat
ctggcaacactgaggcagatccacagacagcatgtcatggtgatcccatttgaaaacctc
agcattcactgtggtgagagaatcacgttggacctgcaggttattttcgataaggaggtg
agaagcaatcgtggcggttgctgcttagaaaacaactgtctgttcaactgggtgctgaga
gaaatgggctacgacgtaacaatgttaggagccagagttttcgacacagacaccaacgat
ttcaccgcgacagaagatcatctcatcaacaaagttgtgattgatggaagagcttacatt
gcggatgtgagcttcgggatgtcgtctcaaatcctggagccactggagctcatctcaggg
aaggagcagcctcagcctgtagcagtctttcgtctggtagaggagggggagacctgggtg
ctggaaaagacaagcaggaagaaagttaccgcggcagagttttctgattcacccttgatt
gacaagaagccgtcaggaaagatctactgcttctccttggctcccaggcaggtcgaccat
ttcctggagttcaaccacagccttcagacagatcctgattcactcttcaccaataaatca
atctgctccctgcaaacaccgacaggattcagaggcctggtcggcctgagctacagccag
gtcaccttcaaacctgaggaaggagtagatcttatcgacatgcaggacataccagaagag
gaagtggagcggattctttgggagaagtttggtgtgaagctgcagaacaagctgaagcct
gtgaaccaaaaagcatcctttactctctaa

DBGET integrated database retrieval system