KEGG   Cynoglossus semilaevis (tongue sole): 103383447Help
Entry
103383447         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103383447
   04020 Calcium signaling pathway
    103383447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csem04040]
    103383447
Ion channels [BR:csem04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103383447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 103383447
NCBI-ProteinID: XP_016890426
Position
9
AA seq 2248 aa AA seqDB search
MTSEEEEGPGVAASTPSGAAATSRVTRVAARGNNDDTVTSSSPRRPSPYRLPRPTEKEEE
EEEIEEEGIIQEDRIEEEEEEEVDCSRNNHEEEDDDDDDDEEANSDTSMLVVPYPELVPV
VFFCLKQTTCPRSLCIRLVCSPWFERVSMMVILLNCVTLGMYQPCENIDCSSEHCQVLQA
FDAFIYIFFALEMVIKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNVNFTAI
RTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRN
RCFLEENFTLTTGISLPRPYYIPDEDDERPFICSLPVDNGIMSCSDVPARREGGKTCCLD
KDDALYRQSLGLSPEPLVNGSVSVAGLCVNWNRYYTRCHTGHRNPHKGAINFDNIAYAWI
VIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRE
HQLMQEQRARFSSSSTLASEPGDCYEELFQLVCHLLRKARRQTVNFFNTLRGKPRGFRGV
GRGRGRGEGRERKANGRGGRERRAVTRHGPPCPHHSKPDHSASGQPAALAAAPPSDGCPR
CAAALALTDGVGPVRSAAGGETEEGGVEEADREGGQSGANEKSGGEKSQDGARCCWGCRP
RKRCKELWYNVRLKLWGIVESKYFNRGIMIAILINTISMGIEHHQQPEELTNVLEICNIV
FTSMFSLEMVLKITAFGSFNYLRNPYNVFDGIIVIISVCEIVGQSDGGLSVLRTFRLLRV
LKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTETGDTV
PDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAATSPFAALYFVALMTFGNYVLFNLLV
AILVEGFQAEGDANRSYSEDDRSPSNFDESERHDSIKLSDPRICTLTPNGHVELGAVSIG
RGSYSSERRSFTLESRKSSVMSLGKSSLERRSLSLRHGRSTNYHNWGRPFPPQSGWNRRS
SSYSLGRRSYRFGGTPLVGGSLRLHSSRSPHSYNFVPEQESLLSHQPHSHHPLLSHHPPP
PPLLLSRHSSVRRDRRALSLELPELLRTGGQPQGPPAGHQDPGRRSGSGAGGSITGGSRD
GSGVGVDHRDCNGKAPGPHTLLMTDVFPQVNARKDRADLDEETDYSLCFRIQKMMEAYRP
DWCETREDWSVYLFSPQNKFRLLCQSIIAHKLFDYVVLVFIFLNCITVALERPRILQGSL
ERLLLTISNYVFTAIFVAEMTVKVVSMGLYLGETAYLRSSWNILDGFLVFVSLIDIVVSM
AGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPIGNIVLICCAFFIIFG
ILGVQLFKGKFYYCVGLDVKNITNKSDCLAANYRWIHHKYNFDNLGQVQPAGGTAQKLPY
YSSYGPARLAIHKLCTSHYLDLVITFIICINVITMSLEHYSQPQSLETALKYCNYFFTST
FVIEASLKLVAFGFRRFFKDRWNQLDLAIVLLSVMGITLEEIEINASLPINPTIIRIMRV
LRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGELVCNAD
YPCEGMSRHATXXXXXXXXXXXXRALFQVSTGDNWNGIMKDTLREACSXCHAGLQFISPL
YFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELELAQGGLCCMMGNIGA
IAGTTGGAAGGASVSGIMSSAIQAGTVGSPSGMVSAPLRDGGSGCAARDGHTHRQCQLYS
PAQESQWLDSVSLLIKDSLEGDMIDNLSGSVFHHYCSPPVCKDCKSHPQEIRLAEVEQAS
LMSEQLSDKSSSPALPDDLSLDEHSNYHLLVRDGQVDSSDSHSSQELPTQVGYSGLGPCS
SGSEEGIQELFQVGVHSQGNPPTRELQSLAQITDDDGESRSGAGAGASPLIHLPADFFHP
AAAAHPGSPGNAAGPGDAAASTLASPASWASLRSPGANSRPLGSQHPSRSDSSLADGSSE
GSLHSTPEEGLGFNVSQPRDTDLPVPLLCPLPSQPLNPQESVSGDQDKTLLKRRSTTVTL
KATRGHQRSQSSCGGGSTSPGYPRQDSMDPSDEDVGPQSGSDGCRQTWNSEHLSETLISL
SLTSLLTPGSLAQPLVKKCNSTGSLDQTNLSARSKDGRHVYSIDAHGFLSNPWTEGKDTG
AEEDSGTTGFGRGRRSSRPTDTTSRKNR
NT seq 6747 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtgaggaggaggagggccccggtgttgccgcatcaacaccgtcaggagcggcg
gccacttccagggtaacaagagtggcagccaggggcaacaacgatgacacggtcacttcc
tcctccccccgcagaccatccccgtaccgcctcccccgtcccacggagaaggaggaggaa
gaggaggagatagaggaagaagggattattcaggaagatcggattgaggaggaggaggaa
gaggaagtggattgtagtaggaataatcatgaagaggaggatgatgacgacgacgacgat
gaagaggccaacagtgacaccagcatgttagtggtgccctaccctgagctggtgccggtg
gtcttcttctgcctgaagcagaccacctgcccccgcagcctgtgcatccgtctggtctgc
agtccatggttcgagcgtgtcagtatgatggtgatcctgttgaactgtgtgaccctgggg
atgtaccagccctgcgagaacatcgactgctcctcggaacactgccaggtactgcaggcc
tttgacgcgttcatctacatcttcttcgctctggagatggttataaagatggtcgccctg
gggatcttcggccgtcgctgttaccttggggacacctggaaccgactggacttcttcatc
gtcatggcgggaatggttgaatattctctggacctacagaacgtcaacttcactgccatc
aggactgtgagagttcttcggcccctgaaagctattaaccgggtaccaagtatgcgtatc
ctggtcaacctgctcctggacaccctgccgatgctgggcaacgtcctcctcctctgcttc
ttcgtcttcttcatctttggcatcattggcgttcagctgtgggcggggctgctgaggaac
cgctgcttcctggaggagaactttactctcaccactggcatcagcctgcctcggccctac
tacatccccgacgaggacgacgagcggcccttcatctgctcgctgcccgtcgacaacggc
atcatgtcctgctccgacgtccccgctcgacgagaaggcgggaagacgtgctgcttggac
aaagacgacgccctgtaccgacagtcgctgggcctgagccccgagccgctggtcaacggc
agcgtcagcgtcgcagggctgtgcgtcaactggaatcggtactacaccaggtgtcacacc
gggcacaggaacccgcacaaaggagccatcaattttgacaacatcgcctacgcctggatt
gtcatcttccaggtgatcactctggagggctgggtggagatcatgtactacgtgatggac
gctcactccttctacaacttcatctacttcatcctgttgatcatcgtcgggtccttcttc
atgatcaatctgtgcctggtcgtcatcgccacccagttctcagaaaccaagcagagggag
catcagctgatgcaggagcagagagcgcgcttctcctcctcctccaccctggccagtgag
ccgggggactgttacgaagaactctttcagctggtctgccacctccttcgcaaggccagg
agacaaactgtcaacttttttaacacgctgcgtgggaaaccacgtggctttcgtggcgtc
ggaagaggcaggggacgaggcgagggacgagagaggaaggccaatggacgaggagggcgt
gagagaagggcggtgacgaggcacggccctccctgcccccaccacagtaaacccgaccac
tcggcgtctggtcaacccgcggccctcgctgcagccccaccctccgacggctgccctcga
tgtgccgcagccctggcgctcacggacggtgtcggccctgtacgcagcgcagccggtgga
gaaacggaggagggcggcgtggaggaagcagacagggagggcggacagtctggagctaac
gagaagagcggcggcgagaagagtcaggacggcgcacggtgctgttggggctgcagaccc
aggaaacgatgcaaggagctgtggtacaacgtgaggttgaagctgtggggcatcgtggag
agcaagtacttcaacagaggcatcatgatcgccatcctgatcaacaccatcagtatgggc
atcgaacaccaccagcagccagaggagctcacgaacgttctggagatctgcaacattgtc
ttcaccagcatgttctccctggagatggtcctcaaaatcacagcctttggctcattcaat
tacctccgaaacccctacaacgtcttcgacggaatcatcgtcatcatcagtgtgtgtgag
atcgtgggtcagtctgacggcggcctctcggtgttgaggaccttcaggctgctgagggtg
ctgaagctggtcagattcatgcctgctctgaggagacagctggtggtcctgatgaagacc
atggacaacgtcgccaccttctgcatgcttctcatgctgttcatcttcatcttcagtatt
cttggaatgcacatcttcggttgtaagttcagtttgaagacggagacgggtgacacagtt
cctgacaggaaaaactttgactccctcctctgggccattgtgaccgtatttcagattttg
acacaagaggactggaacgtggttctgtacaacggtatggcagcgacctcaccgttcgct
gccctgtacttcgtggctcttatgacgtttggaaactatgtcctctttaacctcctggtc
gccatcttggttgaaggctttcaggctgagggcgacgccaatcgctcttactcagaagac
gaccgctctccctctaattttgatgaaagtgagagacacgactccatcaaattgtcagat
ccgaggatctgcaccctaacacccaacggtcatgtggagctgggtgctgtttccattggc
cgaggatcttattcatccgagcgacgcagcttcaccttggagtccaggaagagcagcgtg
atgagtttggggaagagcagcctggagagacgctccctctctctgcgccatgggcgtagt
accaactaccacaactgggggcgcccttttcctccacagtcgggatggaaccgcaggtct
agctcctacagcctgggcaggaggagttacaggtttggaggaactcctctggtagggggc
agccttcgcctgcacagcagccgctcccctcactcgtacaactttgttccggagcaggag
tcccttctctcacaccaaccccactcccatcaccctttactgtctcatcacccccctccg
cccccgttgttgctctcaagacactcgagtgtgaggagagatcgacgggcgttgtccctg
gagctcccagaactgctgcggacgggcggacagcctcaaggcccacccgctggtcatcaa
gaccccgggagacgcagcgggtctggggcaggagggtccatcaccggtgggtccagagac
ggtagtggtgttggagtggaccaccgggactgtaacggcaaggcgccgggaccccacacc
cttctgatgactgacgtgttcccacaagtcaatgcacgcaaggacagagcagatctggac
gaagagaccgactacagcctgtgcttccgtatccagaagatgatggaggcttaccgccca
gactggtgcgaaaccagagaggattggtcagtttatctgttctctccacagaacaagttc
agactcctctgccagtccatcatcgcccataagctgtttgactacgtggtcctggttttc
atctttctcaactgcatcacagtggccctggagaggcccagaattttacagggaagcttg
gaacggctgcttctgaccatttccaactacgtcttcacggctatttttgtagctgagatg
acagtcaaggtggtgtccatgggtctgtacctgggggagacggcctacctgaggagcagc
tggaacattctagatggcttcctggtcttcgtctcgttaattgacatcgtggtgtccatg
gccgggggggcaaagatcctgggggtgctgcgcgttctcaggctgctcaggacactgcgc
cccctcagggtaatcagcagagctccggggctgaagctggtggttgagaccctcatcaca
tccctcaagcccatcggcaacattgttctgatctgctgtgctttcttcatcatctttggc
atcctcggtgttcagctcttcaaaggcaagttctactactgcgtgggtctggacgtgaag
aacatcaccaacaaatccgactgtctggccgccaactatcgatggattcaccacaagtac
aacttcgacaacctgggacaggtacagccagcagggggcaccgcccagaaactgccctac
tattcctcctacggccctgcacgcttggcgatccacaaactgtgcaccagccactatttg
gatctagtcatcaccttcatcatctgcatcaacgtcatcaccatgtccctggagcactac
agccagccacagtctctggagacggcgctgaaatactgcaactacttcttcacctccacc
tttgtgatcgaggcctctctcaaactggtggcttttgggttccggcgcttcttcaaagac
aggtggaaccagttggacctggctatcgtgctgctgtcagtgatgggcatcaccctggag
gagatcgagatcaacgcctcgctgcccatcaatcccaccatcatcaggattatgagggtg
ttaaggatagcacgagttttaaagttgctgaaaatggcaaccgggatgagagctttgctt
gacacagtggtccaagctctgcctcaggttggaaatctgggtcttctcttcatgttgctg
ttcttcatctacgctgctctgggagtggagctgtttggagagctggtgtgtaacgctgac
tatccctgcgaggggatgagccgccacgccacctnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnncgcgcgctcttccaggtttctacgggggacaactggaacggcatcatgaag
gacacactgagagaggcgtgttcgncctgccacgcagggcttcagttcatctccccgttg
tactttgtgtcttttgtgctgacggctcagttcgtcctgatcaacgtggtggtggccgtc
ctcatgaagcacctggacgattccaacaaggaggctcaggaggacgccgagatggatgct
gagatagagctggagctggctcagggaggcctctgctgcatgatgggaaacatcggggcc
atcgccggaaccaccgggggggcggcaggtggggcgagcgtgagcggaataatgtcaagt
gcgattcaagcgggaacggtgggaagcccaagtggaatggtgagcgcaccactacgagat
ggaggaagcggctgcgcggctcgtgacggacacacacaccgtcagtgtcagctttattct
ccggctcaggaaagccagtggctggacagtgtgtctctgctgattaaagactcgctggag
ggagacatgatcgacaacctctctggttcggttttccaccactactgttctccccctgtc
tgcaaagactgcaagagtcacccacaggagatccgattggctgaggtggagcaggcgtct
ctcatgtcggagcagctgtcggacaaatcctcgtctcctgctctgcctgatgacctcagc
ctggatgaacacagtaactaccacctgctggtcagagacggtcaggtggacagcagtgac
tcccacagttcacaggagttgcccactcaggtgggctacagtggacttggtccgtgcagc
tctgggagtgaggaggggatccaggagttgttccaggtgggcgtccattctcaggggaac
cctcccacacgtgagctgcaaagtttggcacaaatcacagatgatgatggagaaagtcga
agcggcgctggtgcaggagcttcgcctctcatccacctccccgctgacttcttccaccct
gctgcagcagctcacccaggcagtcctgggaacgctgccggtccaggagacgcagcggcg
tccacgttggcttctccagcctcttgggcctccctgcgctcaccaggtgccaacagcagg
cccttgggctctcagcatccatctcgcagtgactcctccctagcagatggcagttcagag
ggtagcctgcactccactcctgaggaaggtctgggctttaatgtctcccagccgcgggac
acagatctcccagtgcctctcctctgccctctccctagccaaccactaaatccccaggaa
tctgtatcaggggaccaggacaaaactttactaaagagacgaagcactacagttacccta
aaggccaccagggggcaccagaggagccagagcagctgcggtggtggcagcactagccct
ggctatcctcggcaagactccatggacccgtcggatgaagacgtgggtccacagtcgggg
tcggacggctgccgacagacctggaacagtgaacacttgtcagaaacactcattagcctc
tcgctgacctcactgctcacccctggctctctggcacaaccactggtcaagaaatgtaat
agcacaggttctttagaccaaaccaacttgtctgcgcggagtaaagatggccgccatgtg
tacagtatagatgcccatggtttcttgtctaacccttggacagaaggtaaagacacgggt
gcagaagaggacagtggaacgacaggcttcggcagggggcgccgcagcagccgaccaaca
gacacaacctcaagaaaaaatagatga

DBGET integrated database retrieval system