KEGG   Cynoglossus semilaevis (tongue sole): 103384541
Entry
103384541         CDS       T04866                                 

Definition
(RefSeq) adenylate cyclase type 4-like
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00230  Purine metabolism
csem01100  Metabolic pathways
csem04020  Calcium signaling pathway
csem04114  Oocyte meiosis
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04371  Apelin signaling pathway
csem04540  Gap junction
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103384541
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103384541
   04020 Calcium signaling pathway
    103384541
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103384541
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103384541
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103384541
   04914 Progesterone-mediated oocyte maturation
    103384541
   04916 Melanogenesis
    103384541
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103384541
   04270 Vascular smooth muscle contraction
    103384541
Enzymes [BR:csem01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103384541
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 103384541
NCBI-ProteinID: XP_008316318
UniProt: A0A3P8WQF4
Position
1
AA seq 1263 aa
MMPEGDQDQTGVEEEGENAKSLVPDVAISCSSGQNMPAVELEDFSQTSDAIQEFMNNSNI
VFENSPGFNEPKESGLVETAKVPEPLTLKGLDLDTHDVLDSGAFIFNTNLCSDALSEDDS
SSLEKTNHVNFSELESDSTMDLHISDGNQENPLEENAKSPNCGSSPTLADGSPAVYQVRD
SIDVRWDDSDNDDDQRSILSRQSMKDGMCCCYQTFHRACLRCVEETPAMLSGLVLSIVFC
VVIIILIPTTGRDAKTHVGALAVVCVVLCLSTLLLVCLPWLATVRRCGGALALFVWGTLY
TVAVVFIFTGGPVTAWEQVAFFLFLTLSVYTVLPLSLTWALIVGIWTSVSHIIIISVYVA
TTSPNTPDLAVQLVANAVLFLCVNCIGIFHLWTTEHDLRLSNQKREEFSAIRSQKEIKKY
QQEQLLLSVLPRYIAMELKTEVIKRLTKPKSEKENESKLNNFHSLYIRQHKDVSILYADI
VGFTKLASTCTPEELVAVLNKLFGRFDDIAKKNGCLRIKILGDCYYCVSGLPDPIPTHAK
NCVQMGLDMCRAISKLREATSVDINMRVGVHTGYVLCGVIGLQKWQYDVWSHDVTLANHM
ESGGLAGRVHITEETLHHLNEAYQVEDGNGGSRDPLLQGRETYLVIDPRETERISRRPKV
VNSLVSGESRQRVSVRMSQYMQSWRTIHPFADLSNPDSNGPMKRNFPCNLVSSKLQQTGD
RPPNHNNPGCLVVDSRVRASLETVDIAWRRAKKLNCLTLLFNDLSLEKQFRVSEVKGLHK
SIICISMIFITLFTVQMLVSEKNFEMAVSYGATFPVLILLLSMSFTGYLEKWRSKIPAGV
QWISGLNHRLATKVVLRLFVVLLCVLITLLMAILNFFFLPGNNCTAVTNSSEMEGLKLYT
VPYYLYCCLLAMLGVIVFVKICLSIKALLLTLAVVVYLALFLEVYASRSFCLVDLLYNDT
MPGVLKDPHIMSGVWLVIFFIICLILARQDELSCRVDFLLDHCFQAEREEMETMENVNKL
LLQNVLPLHVASFFMGKTIRNQDLYSQSYDCVCVMFASVPQFKEFYSESSANRDGLECLR
FLNEIIADFDELLSKPKFSSVEKIKTIGSTYMAAAGLTHSPPGDERKKQEMSYSHVRAMV
EFAFALMAKLELINTHSFNSFKLRIGINHGPVIAGVIGAHKPQYDIWGNTVNVASRMDST
GVLDKIQVTEETTHMVENVGYTVTLRGVVNVKGKGQLTTYFVDTDQCIRRLGSDFQGSNI
TQT
NT seq 3792 nt   +upstreamnt  +downstreamnt
atgatgccagaaggtgatcaggatcagacgggggttgaggaagaaggagagaacgctaaa
tcactcgtgccagatgtggctatttcctgcagtagtgggcaaaatatgccagcagttgaa
cttgaagatttcagtcaaacatcagatgctatccaagagttcatgaataacagtaacatt
gtttttgagaacagtccaggatttaatgaacccaaagagtccggattagttgaaaccgca
aaagtccctgaacctttgaccttgaaaggtttggacctcgacacccatgatgtcttagac
agtggcgctttcatttttaacaccaacctttgcagtgatgccttatctgaagacgacagt
agctcacttgaaaagactaatcatgtcaatttctcagaacttgaatcagactctaccatg
gatttgcatatttcagatggaaatcaggaaaatccgcttgaagaaaatgcaaaaagccca
aactgtggcagttcacccacattggcagatggctcacctgcagtttaccaagtgagggac
agcattgacgttaggtgggacgactcagataatgacgacgaccaacgtagtatcttgtcc
aggcagagtatgaaggatggcatgtgctgctgctaccagacctttcacagggcgtgtcta
cgatgtgtggaggagacgccggccatgctgtctggactagtgttgtctatagtcttctgt
gtggtcatcatcatcctcattccaaccactggacgggatgccaaaactcatgttggtgct
ttggcagtcgtgtgcgtggtcctctgtcttagcacactcttgcttgtgtgtttgccttgg
ctcgccaccgtgcggcgctgtggaggcgccctggccctctttgtctggggaacgctgtac
accgtagctgttgtgttcatcttcactggaggccctgtcactgcatgggaacaggtggcg
tttttcctcttcctgactctcagtgtctacacagtgctccctctttctctgacctgggcg
ctcatagttggaatctggaccagtgtttcacacattatcatcatcagtgtgtatgttgcc
accacaagcccaaacacaccagacttggctgtgcagctggttgcaaacgcagtgctgttt
ctatgtgtgaactgcattgggattttccacctgtggacaacggagcacgatctcaggcta
tccaatcagaaaagagaggagttcagcgccattcgctcccagaaggaaattaagaaatat
cagcaggagcagctcctcttgtcggtgttgccacgctacatcgccatggagctaaagacg
gaggtaataaagaggctgaccaagcccaagagtgaaaaggaaaacgaatccaaactcaac
aactttcacagcctctacatacggcagcacaaagacgtcagtattctctatgcagacatt
gttggcttcactaagttggcaagtacctgcactccagaagagttggttgctgtgctcaac
aagctctttggccgatttgatgacatagccaagaaaaatggatgtcttcgcatcaaaatc
ctcggtgactgctactattgtgtgtccggtctccctgatcccatcccgactcatgcaaag
aactgtgtacagatgggcctggacatgtgcagggctatcagtaaactgcgagaggcaaca
agtgttgacatcaacatgcgtgtgggcgttcacactggctatgtgctctgtggtgtgatt
ggcctgcagaagtggcagtatgacgtttggtcacatgatgtgacattggccaaccacatg
gagtctggaggtctggctggacgggtccacatcacggaggaaacactgcatcatttgaat
gaagcgtaccaagtggaggatgggaatgggggaagtcgagatcctcttcttcagggaaga
gaaacctacttagtaatcgatcctcgtgaaacagaacgcatttcaaggaggcctaaagtg
gtgaacagtcttgtatcaggtgagagcaggcagcgcgtgtcagtgaggatgtctcagtac
atgcagtcctggcggaccattcacccctttgctgacctcagcaaccctgacagcaatggc
ccaatgaagagaaacttcccatgcaatcttgtttccagcaagttgcagcaaactggagac
agacctccaaaccacaacaaccctggatgtctggttgtggacagtcgtgtcagggcatca
ctggaaacagtggacattgcatggcgcagagctaaaaagctcaactgtttgacacttctg
tttaatgaccttagtctggaaaaacagttcagagtttcagaggtgaagggcttgcacaag
tcaataatctgcatctccatgatcttcatcactctcttcaccgtccagatgctggtctct
gaaaagaactttgagatggcagtttcttatggtgcaaccttccctgttctcatcctgctt
ctgtccatgtccttcacagggtatttggagaaatggcgctccaagataccagctggagtt
cagtggatatcaggacttaaccataggctagccaccaaggtggtgctgcgtctgtttgtg
gtccttctctgtgtgcttattaccctgctcatggccatccttaactttttctttctacca
ggaaataactgcactgctgtcaccaacagttctgagatggagggtctcaaactctacact
gtgccttattacctgtactgctgcctgctagcaatgctgggtgtgatcgtgttcgtcaag
atatgtttgtcaattaaagctctgctgttaactctggccgtggtggtttacctcgcactc
ttccttgaagtttacgcttcacggtccttctgcctcgttgaccttctctacaacgacaca
atgccaggcgtactgaaagatcctcacatcatgtctggggtttggctggtcatctttttc
atcatatgcctcatactggccagacaggatgagctaagttgccgtgtggacttcctattg
gatcactgtttccaagcagagcgtgaggagatggagaccatggagaatgtcaacaaactg
ctcttgcagaatgtcctgccactccacgtcgcctccttcttcatgggcaaaactatccgc
aaccaggacctgtacagccagtcctacgactgtgtgtgcgtaatgtttgcctcagttccc
caatttaaagagttctacagtgagagcagtgccaacagagatgggctggagtgtctgcgc
ttcctcaatgagattatcgccgactttgatgaactgctctcaaaacccaaattctcttca
gtggagaaaatcaaaacaatcggcagcacgtacatggcagctgcaggactgacgcactca
ccaccaggggatgaaagaaagaaacaagagatgtcctacagtcacgtgagagccatggtg
gagtttgcattcgctctcatggctaaactggagctcatcaacacacattccttcaacagc
ttcaaactcaggattggtataaaccatggaccggtgattgctggagttattggagctcat
aaacctcagtatgacatctggggcaacactgttaatgtggccagtagaatggacagcacg
ggagtgttggacaagatccaggtgacagaggaaactacacatatggtggagaacgttggc
tacaccgtcactctgaggggtgtcgttaacgtgaagggcaaaggccaacttaccacctat
tttgtggacacggaccagtgcatccgtcggctcggttcagatttccagggatcaaacatc
acgcagacctaa

DBGET integrated database retrieval system