KEGG   Cynoglossus semilaevis (tongue sole): 103384991Help
Entry
103384991         CDS       T04866                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00561  Glycerolipid metabolism
csem01100  Metabolic pathways
Module
csem_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103384991 (mgll)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csem01002]
    103384991 (mgll)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103384991 (mgll)
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S33
   103384991 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 PGAP1 Thioesterase Peptidase_S9 LIDHydrolase Abhydrolase_2 Abhydrolase_5 Chlorophyllase2 DUF1057 DUF1350
Motif
Other DBs
NCBI-GeneID: 103384991
NCBI-ProteinID: XP_008316952
Position
10
AA seq 367 aa AA seqDB search
MCFSVDESVFCACWDYNRHIPNRLILSSQTLPIVGIMRAVTAATCLLAAGLSCFFYGSDV
LPLLGGLSLSDPASMPERRSPQGVLYTDLQHIVNADGLHLFCRYWEPVEPPRALVFIVHG
TGEHSGPYDEIAQKLRDQSLLVFAHDHVGHGQSEGERMNVKDFQVYIRDSLQHIDLMKSR
HPDLPVFILGHSMGGAVAILTACERPSDFAGVVLIAPMIKMNPESATPFKVFLAKVLNHV
LPRLPLGSINSKWVSRDKSKVEAYDADDLNHHGGVRVSFGWQLMGAAARIEKEIPTISWP
FFLLHGDADKLCDIRGSKIMFDKAPSPDKKIKIYEGGYHALHLDLPDVAQSVLKEVSAWI
TEHLPLN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttttctgttgacgagagtgtgttttgtgcatgttgggattataaccgacatatt
cctaaccgactaatcctgtcatcgcaaacattgcctatagtcggaataatgcgtgcggtg
accgccgccacctgcctgctcgccgccggcttaagctgctttttctacggcagcgacgta
ttaccgctgctcggtggtttgtctctttcagacccagcatccatgccggagcggcggagc
ccgcagggagtcctgtacacggacctccagcacattgtcaacgccgacggactgcacctg
ttctgccgctactgggagcctgtggagccgccaagggctctggtgtttatcgtccatggc
accggggagcattctgggccgtatgatgagattgcacaaaaactgagggaccagtctttg
ctggtatttgcacacgaccacgtgggccacggtcaaagtgaaggagaaagaatgaacgtc
aaagacttccaggtttacatcagagactcactgcagcacattgacctgatgaagtcccgt
cacccagacctaccagtcttcattctaggtcactccatgggcggcgccgtggccatcctc
acagcctgtgaaaggcccagtgattttgctggcgtggttctgatcgcaccgatgatcaaa
atgaacccagaatctgcaacgccgttcaaagtttttctggctaaggtcctgaaccacgtg
ctgcccagactccctctgggcagcatcaattccaaatgggtttcccgggacaagtcaaag
gtggaggcctatgacgcagacgacctgaaccaccacggtggggtcagggtgtcgttcggg
tggcagctgatgggggctgcggctcgcatagagaaggaaatcccgaccatcagctggccg
ttctttctcctgcacggtgacgccgacaaactctgtgacatcagaggttctaagatcatg
tttgacaaggctccaagtccagacaagaagatcaagatctatgagggaggctaccacgcc
ctccatctggacctgcccgacgtggcccagtccgtgctgaaggaagtgtcggcctggatc
acagagcacctgcccctgaactaa

DBGET integrated database retrieval system